Signs of Aging Skin

10 items
New Arrivals
Picked just for you.
Start shopping now.
JACQ's Beta-Acid Acne Treatment JACQ's Beta-Acid Acne Treatment
{"id":10500476675,"title":"JACQ's Beta-Acid Acne Treatment","handle":"the-high-priestess-beauty-booster","description":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-06-09T16:32:27-04:00","vendor":"JACQ'S","type":"Skin Care","tags":[],"price":1900,"price_min":1900,"price_max":1900,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636551619,"title":"1\/2 oz","option1":"1\/2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793009504304,"product_id":10500476675,"position":3,"created_at":"2021-08-09T15:23:56-04:00","updated_at":"2021-08-09T15:49:07-04:00","alt":null,"width":934,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","variant_ids":[40636551619]},"available":true,"name":"JACQ's Beta-Acid Acne Treatment - 1\/2 oz","public_title":"1\/2 oz","options":["1\/2 oz"],"price":1900,"weight":5,"compare_at_price":null,"inventory_quantity":138,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","options":["Size"],"media":[{"alt":null,"id":21058558591024,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058521497648,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"},"aspect_ratio":0.869,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","width":934},{"alt":null,"id":21058521464880,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e"}
{"id":10500480579,"title":"JACQ's PROBIOTIC FACE MASK","handle":"probiotic-face-mask-1","description":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:34-04:00","created_at":"2017-06-09T16:34:13-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","antioxidant","booster","Carrot","emollient","essential oils","Face Mask","face oil","face serum","jackfruit","moisturizer","papaya","protein","skin serum","vitamin E","yucca"],"price":2300,"price_min":2300,"price_max":2300,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636604483,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":29235789692976,"product_id":10500480579,"position":1,"created_at":"2021-12-15T14:18:06-05:00","updated_at":"2021-12-15T14:18:22-05:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902","variant_ids":[40636604483]},"available":true,"name":"JACQ's PROBIOTIC FACE MASK - 2oz","public_title":"2oz","options":["2oz"],"price":2300,"weight":85,"compare_at_price":null,"inventory_quantity":148,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21516283084848,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1639595902","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1639595902","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1639595902","\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsprobioticfacemask937x1075_efe4003d-666a-4729-8141-dcb8f6678803.jpg?v=1639595902"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902","options":["Size"],"media":[{"alt":null,"id":21516283084848,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902","width":937},{"alt":null,"id":21058609020976,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1639595902"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1639595902","width":937},{"alt":null,"id":21058585428016,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1639595902"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1639595902","width":937},{"alt":null,"id":21058608988208,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1639595902"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1639595902","width":937},{"alt":null,"id":21058594865200,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsprobioticfacemask937x1075_efe4003d-666a-4729-8141-dcb8f6678803.jpg?v=1639595902"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsprobioticfacemask937x1075_efe4003d-666a-4729-8141-dcb8f6678803.jpg?v=1639595902","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's Drip Collection Skincare Bundle - Save $10
{"id":10612520899,"title":"JACQ's Drip Collection Skincare Bundle - Save $10","handle":"beauty-boosting-trio","description":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-11T19:04:44-04:00","created_at":"2017-07-09T17:02:19-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","beauty booster","booster","chamomile","face oil","face serum","moringa","protein","protein booster","skin serum","yucca"],"price":6500,"price_min":6500,"price_max":6500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42098492355,"title":"1","option1":"1","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793140805680,"product_id":10612520899,"position":1,"created_at":"2021-08-09T16:36:51-04:00","updated_at":"2021-08-09T16:39:03-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","variant_ids":[42098492355]},"available":true,"name":"JACQ's Drip Collection Skincare Bundle - Save $10 - 1","public_title":"1","options":["1"],"price":6500,"weight":5,"compare_at_price":null,"inventory_quantity":245,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","options":["1 Pack"],"media":[{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's Restorative Face Serum JACQ's Restorative Face Serum
{"id":10636301379,"title":"JACQ's Restorative Face Serum","handle":"jacqs-restorative-face-serum","description":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-07-14T13:01:45-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["amino acids","booster","chamomile","hibiscus","Moringa","plant nutrients","Vitamin A","Vitamin D"],"price":2400,"price_min":2400,"price_max":2400,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42338644867,"title":"1oz","option1":"1oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793074614320,"product_id":10636301379,"position":1,"created_at":"2021-08-09T16:11:09-04:00","updated_at":"2021-08-09T17:44:38-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","variant_ids":[42338644867]},"available":true,"name":"JACQ's Restorative Face Serum - 1oz","public_title":"1oz","options":["1oz"],"price":2400,"weight":5,"compare_at_price":null,"inventory_quantity":43,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","options":["Size"],"media":[{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","width":937},{"alt":null,"id":21058578481200,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","width":937},{"alt":null,"id":21058578513968,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","width":937},{"alt":null,"id":21058578546736,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e"}
JACQ's Healing Face Cleanser JACQ's Healing Face Cleanser
{"id":10500323523,"title":"JACQ's Healing Face Cleanser","handle":"healing-face-cleanser","description":"\u003ch3\u003e\u003c\/h3\u003e\n\u003ch2\u003eJACQ's Vegan, Cruelty-free Face Cleanser with Papaya \u0026amp; Moringa Extract\u003c\/h2\u003e\n\u003ch3\u003eFace Cleanser for Oily \u0026amp; Combination Skin \u003c\/h3\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003e\n\u003cspan\u003eA game-changing face cleanser that \u003c\/span\u003e\u003cstrong\u003edissolves dirt, makeup, and impurities on the skin.\u003c\/strong\u003e\u003cspan\u003e Creamy in texture, pink in color this cleanser is formulated with rich \u003c\/span\u003e\u003cstrong\u003eAmino Acids, Fruit Enzymes\u003c\/strong\u003e\u003cspan\u003e found in \u003c\/span\u003e\u003cstrong\u003ePapaya Extract\u003c\/strong\u003e\u003cspan\u003e to gently remove dead cells. Skin conditioning \u003c\/span\u003e\u003cstrong\u003eVitamin B3\u003c\/strong\u003e\u003cspan\u003e and healing \u003c\/span\u003e\u003cstrong\u003eMoringa Extract\u003c\/strong\u003e\u003cspan\u003e all work together to leave skin feeling clean and refreshed.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e\u003cspan\u003eWater (Aqua), *Helianthus Annuus (Sunflower) Seed Oil, *Cocos Nucifera (Coconut) Oil, *Ricinus Communis (Castor) Seed Oil, , Potassium hydroxide, *Glycerin, *Citric acid, Moringa Oleifera Seed Extract, Carica Papaya (Papaya) Fruit Extract, Spearmint Oil, Eucalyptus Oil, Peppermint Oil, Ginger Oil, Pure Essential Oils and Kaolinite (Rose Clay). *Certified Organic\u003c\/span\u003e\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cspan\u003eMassage onto wet skin, work into a lather, inhale the aroma and rinse. Avoid eye area.\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003ch2\u003e\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003ePapaya \u003c\/b\u003ehigh in Vitamin A \u0026amp; E, omega-fatty acids, and papain enzymes. Papain enzymes work to gently exfoliate the skin while removing dead skin cells.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eMoringa \u003c\/b\u003eis a rich source of fatty acids great for nourishing the skin. It easily absorbs into skin, a powerful plant that fights inflammation and helps protect against free-radical damage.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Clay\u003c\/strong\u003e easily \u003cspan\u003eabsorb impurities from the\u003cstrong\u003e \u003c\/strong\u003e\u003c\/span\u003eskin\u003cspan\u003e, such as dirt, makeup, and oils.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\"\u003e\u003c\/strong\u003e\u003c\/p\u003e","published_at":"2017-07-14T12:13:43-04:00","created_at":"2017-06-09T14:55:17-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":[],"price":1100,"price_min":1100,"price_max":2400,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40633316483,"title":"4oz","option1":"4oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793182748720,"product_id":10500323523,"position":3,"created_at":"2021-08-09T17:15:55-04:00","updated_at":"2021-09-23T12:42:11-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_healing_face_cleanser_937x1075_dc2fbfe9-bc58-4d31-a8d7-fece0f081e01.jpg?v=1632415331","variant_ids":[40633316483]},"available":true,"name":"JACQ's Healing Face Cleanser - 4oz","public_title":"4oz","options":["4oz"],"price":2400,"weight":198,"compare_at_price":null,"inventory_quantity":439,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","featured_media":{"alt":null,"id":21058696282160,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_healing_face_cleanser_937x1075_dc2fbfe9-bc58-4d31-a8d7-fece0f081e01.jpg?v=1632415331"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":22497980317744,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15388578578480,"product_id":10500323523,"position":6,"created_at":"2020-07-16T07:28:45-04:00","updated_at":"2021-09-23T12:42:11-04:00","alt":null,"width":934,"height":1064,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront.jpg?v=1632415331","variant_ids":[22497980317744]},"available":true,"name":"JACQ's Healing Face Cleanser - 2oz","public_title":"2oz","options":["2oz"],"price":1100,"weight":57,"compare_at_price":null,"inventory_quantity":-3,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","featured_media":{"alt":null,"id":7561972908080,"position":6,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront.jpg?v=1632415331"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JACQShealingfacemask937x1075f.jpg?v=1632415331","\/\/\/s\/files\/1\/0877\/4074\/products\/healingcleanser4ozrenderingfront.jpg?v=1632415331","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_healing_face_cleanser_937x1075_dc2fbfe9-bc58-4d31-a8d7-fece0f081e01.jpg?v=1632415331","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealingfacecleanser.png?v=1632415316","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQS_HEALING_FACE_CLEANSER_2_OZ_937X1075_c04780c2-6163-4953-8d10-137ebb71c5a5.jpg?v=1632415331","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront.jpg?v=1632415331"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JACQShealingfacemask937x1075f.jpg?v=1632415331","options":["Size"],"media":[{"alt":null,"id":21058703982640,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQShealingfacemask937x1075f.jpg?v=1632415331"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQShealingfacemask937x1075f.jpg?v=1632415331","width":937},{"alt":null,"id":20697463324720,"position":2,"preview_image":{"aspect_ratio":0.791,"height":1069,"width":846,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/healingcleanser4ozrenderingfront.jpg?v=1632415331"},"aspect_ratio":0.791,"height":1069,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/healingcleanser4ozrenderingfront.jpg?v=1632415331","width":846},{"alt":null,"id":21058696282160,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_healing_face_cleanser_937x1075_dc2fbfe9-bc58-4d31-a8d7-fece0f081e01.jpg?v=1632415331"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_healing_face_cleanser_937x1075_dc2fbfe9-bc58-4d31-a8d7-fece0f081e01.jpg?v=1632415331","width":937},{"alt":null,"id":21179935129648,"position":4,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealingfacecleanser.png?v=1632415316"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealingfacecleanser.png?v=1632415316","width":2048},{"alt":null,"id":21058696806448,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQS_HEALING_FACE_CLEANSER_2_OZ_937X1075_c04780c2-6163-4953-8d10-137ebb71c5a5.jpg?v=1632415331"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQS_HEALING_FACE_CLEANSER_2_OZ_937X1075_c04780c2-6163-4953-8d10-137ebb71c5a5.jpg?v=1632415331","width":937},{"alt":null,"id":7561972908080,"position":6,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront.jpg?v=1632415331"},"aspect_ratio":0.878,"height":1064,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront.jpg?v=1632415331","width":934}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch3\u003e\u003c\/h3\u003e\n\u003ch2\u003eJACQ's Vegan, Cruelty-free Face Cleanser with Papaya \u0026amp; Moringa Extract\u003c\/h2\u003e\n\u003ch3\u003eFace Cleanser for Oily \u0026amp; Combination Skin \u003c\/h3\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003e\n\u003cspan\u003eA game-changing face cleanser that \u003c\/span\u003e\u003cstrong\u003edissolves dirt, makeup, and impurities on the skin.\u003c\/strong\u003e\u003cspan\u003e Creamy in texture, pink in color this cleanser is formulated with rich \u003c\/span\u003e\u003cstrong\u003eAmino Acids, Fruit Enzymes\u003c\/strong\u003e\u003cspan\u003e found in \u003c\/span\u003e\u003cstrong\u003ePapaya Extract\u003c\/strong\u003e\u003cspan\u003e to gently remove dead cells. Skin conditioning \u003c\/span\u003e\u003cstrong\u003eVitamin B3\u003c\/strong\u003e\u003cspan\u003e and healing \u003c\/span\u003e\u003cstrong\u003eMoringa Extract\u003c\/strong\u003e\u003cspan\u003e all work together to leave skin feeling clean and refreshed.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e\u003cspan\u003eWater (Aqua), *Helianthus Annuus (Sunflower) Seed Oil, *Cocos Nucifera (Coconut) Oil, *Ricinus Communis (Castor) Seed Oil, , Potassium hydroxide, *Glycerin, *Citric acid, Moringa Oleifera Seed Extract, Carica Papaya (Papaya) Fruit Extract, Spearmint Oil, Eucalyptus Oil, Peppermint Oil, Ginger Oil, Pure Essential Oils and Kaolinite (Rose Clay). *Certified Organic\u003c\/span\u003e\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cspan\u003eMassage onto wet skin, work into a lather, inhale the aroma and rinse. Avoid eye area.\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003ch2\u003e\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003ePapaya \u003c\/b\u003ehigh in Vitamin A \u0026amp; E, omega-fatty acids, and papain enzymes. Papain enzymes work to gently exfoliate the skin while removing dead skin cells.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eMoringa \u003c\/b\u003eis a rich source of fatty acids great for nourishing the skin. It easily absorbs into skin, a powerful plant that fights inflammation and helps protect against free-radical damage.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Clay\u003c\/strong\u003e easily \u003cspan\u003eabsorb impurities from the\u003cstrong\u003e \u003c\/strong\u003e\u003c\/span\u003eskin\u003cspan\u003e, such as dirt, makeup, and oils.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\"\u003e\u003c\/strong\u003e\u003c\/p\u003e"}

JACQ's Healing Face Cleanser

$ 11.00
JACQ's Vegan, Cruelty-free Face Cleanser with Papaya & Moringa Extract Face Cleanser for Oily & Combination Skin  PRODUCT INFO INGREDIENTS HOW TO USE A game-changing face cleanser that dissolves dirt, makeup, and impurities on the skin. Creamy in texture, pink in color this cleanser is formulated with rich Amino Acids, Fruit Enzymes found in Papaya Extract to...
JACQ's nourishing face moisturizer, pink packaging, clear bottle JACQ's Nourishing Lightweight Face Moisturizer
{"id":10500456259,"title":"JACQ's Nourishing Lightweight Face Moisturizer","handle":"nourishing-face-moisturizer","description":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Organic Hydrating \u0026amp; Tightening Face Moisturizer with Vitamin C \u0026amp; Vitamin E\u003c\/span\u003e\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThis \u003cstrong\u003efast-absorbing light-weight moisturizer\u003c\/strong\u003e delivers a nourishing dose of \u003cstrong\u003epeptides, fatty acids\u003c\/strong\u003e and potent herbal extracts that will leave your skin \u003cstrong\u003erefreshed and hydrated\u003c\/strong\u003e. This nourishing blend of potent roots, an antioxidant cocktail of Vitamins C \u0026amp; E and hydrating Glycerin ties in this soothing formulation. \u003cstrong\u003ePlus it's a build-a-able moisturizer.\u003c\/strong\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003eWater (Aqua), Helianthus Annuus (Sunflower) Seed Oil*, Cocos Nucifera (Coconut) Oil*, Leucidal Bioferment (Radish Root) Extract, Xatham Gum (Non-GMO)*, Vegetable Glycerin (Non-GMO), Glauca (Yucca) Extract, Achillea Millefolium (Yarrow) Extract*, *Daucus Carota Sativa (Carrot) Root Extract*, Echinacea Purpurea Extract*, Arctium Lappa (Burdock) Extract*, Rumex (Yellow Dock) Crispus Extract*, Chamomilla Recutita (Matricaria) Flower Extract*, Panthenol, Squalane (Olive Derived), Rosa Rubiginosa (Rosehip) Seed Oil*, Ferulic Acid, Vitamin E (Non-GMO) and Pure Essential Oils . *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eGently press 2 to 3 drops onto face, neck, and décolleté morning and night.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003ch4\u003e\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\u003c\/h4\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003e Yucca\u003c\/b\u003e is a skin moisturizing root that contains resveratrol, a potent antioxidant known for it's healing properties. It also promotes new cell growth and an ideal ingredient for sensitive and aging skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eCoconut\u003c\/strong\u003e is a hydrating emollient rich in lauric acid and Vitamin E\u003cb\u003e. \u003c\/b\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eVitamin B5 \u003c\/b\u003eis hydrating and skin conditioning. It helps improve the appearance of skin texture and regenerates skin.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"Vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003cimg alt=\"cruelty-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e","published_at":"2017-07-14T12:12:33-04:00","created_at":"2017-06-09T16:23:08-04:00","vendor":"Jacq's Organics","type":"Face","tags":["active ingredients","antioxidant","coconut","face moisturizer","glycerin","lightweight","meta-related-femmecollection","moisturizer","probiotics","rose hip seed oil","vitamin B5","vitamin C","vitamin E","yucca"],"price":2800,"price_min":2800,"price_max":2800,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636345475,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15388635856944,"product_id":10500456259,"position":1,"created_at":"2020-07-16T07:38:59-04:00","updated_at":"2021-08-09T17:43:25-04:00","alt":"JACQ's nourishing face moisturizer, pink packaging, clear bottle","width":937,"height":1065,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerfront.jpg?v=1628545405","variant_ids":[40636345475]},"available":true,"name":"JACQ's Nourishing Lightweight Face Moisturizer - 2oz","public_title":"2oz","options":["2oz"],"price":2800,"weight":85,"compare_at_price":null,"inventory_quantity":102,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":"JACQ's nourishing face moisturizer, pink packaging, clear bottle","id":7562030284848,"position":1,"preview_image":{"aspect_ratio":0.88,"height":1065,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerfront.jpg?v=1628545405"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerfront.jpg?v=1628545405","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075_12b81f59-8e5d-4fb3-ab43-e6879a679e46.jpg?v=1628545405","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofnourishingfacemoisturizer.png?v=1632416411","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerback.jpg?v=1632416413"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerfront.jpg?v=1628545405","options":["Size"],"media":[{"alt":"JACQ's nourishing face moisturizer, pink packaging, clear bottle","id":7562030284848,"position":1,"preview_image":{"aspect_ratio":0.88,"height":1065,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerfront.jpg?v=1628545405"},"aspect_ratio":0.88,"height":1065,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerfront.jpg?v=1628545405","width":937},{"alt":null,"id":21058733834288,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075_12b81f59-8e5d-4fb3-ab43-e6879a679e46.jpg?v=1628545405"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075_12b81f59-8e5d-4fb3-ab43-e6879a679e46.jpg?v=1628545405","width":937},{"alt":null,"id":21180031926320,"position":3,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofnourishingfacemoisturizer.png?v=1632416411"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofnourishingfacemoisturizer.png?v=1632416411","width":2048},{"alt":"JACQ's nourishing lightweight face moisturizer ingredients","id":7562030252080,"position":4,"preview_image":{"aspect_ratio":0.87,"height":1073,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerback.jpg?v=1632416413"},"aspect_ratio":0.87,"height":1073,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerback.jpg?v=1632416413","width":934}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Organic Hydrating \u0026amp; Tightening Face Moisturizer with Vitamin C \u0026amp; Vitamin E\u003c\/span\u003e\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThis \u003cstrong\u003efast-absorbing light-weight moisturizer\u003c\/strong\u003e delivers a nourishing dose of \u003cstrong\u003epeptides, fatty acids\u003c\/strong\u003e and potent herbal extracts that will leave your skin \u003cstrong\u003erefreshed and hydrated\u003c\/strong\u003e. This nourishing blend of potent roots, an antioxidant cocktail of Vitamins C \u0026amp; E and hydrating Glycerin ties in this soothing formulation. \u003cstrong\u003ePlus it's a build-a-able moisturizer.\u003c\/strong\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003eWater (Aqua), Helianthus Annuus (Sunflower) Seed Oil*, Cocos Nucifera (Coconut) Oil*, Leucidal Bioferment (Radish Root) Extract, Xatham Gum (Non-GMO)*, Vegetable Glycerin (Non-GMO), Glauca (Yucca) Extract, Achillea Millefolium (Yarrow) Extract*, *Daucus Carota Sativa (Carrot) Root Extract*, Echinacea Purpurea Extract*, Arctium Lappa (Burdock) Extract*, Rumex (Yellow Dock) Crispus Extract*, Chamomilla Recutita (Matricaria) Flower Extract*, Panthenol, Squalane (Olive Derived), Rosa Rubiginosa (Rosehip) Seed Oil*, Ferulic Acid, Vitamin E (Non-GMO) and Pure Essential Oils . *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eGently press 2 to 3 drops onto face, neck, and décolleté morning and night.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003ch4\u003e\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\u003c\/h4\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003e Yucca\u003c\/b\u003e is a skin moisturizing root that contains resveratrol, a potent antioxidant known for it's healing properties. It also promotes new cell growth and an ideal ingredient for sensitive and aging skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eCoconut\u003c\/strong\u003e is a hydrating emollient rich in lauric acid and Vitamin E\u003cb\u003e. \u003c\/b\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eVitamin B5 \u003c\/b\u003eis hydrating and skin conditioning. It helps improve the appearance of skin texture and regenerates skin.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"Vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003cimg alt=\"cruelty-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e"}

JACQ's Nourishing Lightweight Face Moisturizer

$ 28.00
JACQ's Organic Hydrating & Tightening Face Moisturizer with Vitamin C & Vitamin E PRODUCT INFO INGREDIENTS HOW TO USE This fast-absorbing light-weight moisturizer delivers a nourishing dose of peptides, fatty acids and potent herbal extracts that will leave your skin refreshed and hydrated. This nourishing blend of potent roots, an...
JACQ'S Revitalizing Face Toner JACQ'S Revitalizing Face Toner
{"id":10471658243,"title":"JACQ'S Revitalizing Face Toner","handle":"revitalizing-face-toner","description":"\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eA\u003cstrong\u003e hydrating floral tea for your skin\u003c\/strong\u003e formulated with refreshing Mint, toning and moisturizing \u003cstrong\u003eHibiscus pedals and healing Burdock Root\u003c\/strong\u003e. A perfect blend of herbal extracts,\u003cstrong\u003e fatty acids, and vitamins\u003c\/strong\u003e, this toner was crafted to\u003cstrong\u003e restores skin pH balance. minimize the appearance of pores, tone and remove excess residue from makeup, dirt, and oils\u003c\/strong\u003e.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003eWater (Aqua), *Hibiscus Rosa Sinensis Linn (Hibiscus), *Mentha Citrus Sinensis (Orange Mint), Rosa Centifolia (Rose), *Prunus Amygdalus Dulcis (Sweet Almond) Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Arctium Lappa (Burdock) Extract, *Echinacea Purpurea Extract, *Rumex (Yellow Dock) Crispus Extract, *Chamomilla Recutita (Matricaria) Extract, *Rosa Moschata (Rosehip) Seed Oil, Hippophae Rhamnoides (Sea Buckthorn) Seed Oil, *Aloe Barbadensis Extract, Ubiquinone (CoQ10), Leucidal Liquid (Radish Root Ferment) and Pure Essential Oils . *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eAfter cleansing, moisten a cotton pad with the toner and gently wipe across the forehead, cheek, and throat in an upward with outward motions. Avoid eye area.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"color: #0b5394;\"\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003eBurdock Root \u003c\/b\u003econtains ingredients known for cleansing the lymphatic system. It's antifungal and antibacterial and an ideal ingredient for regulating oil production in the skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eCoQ10 \u003c\/b\u003eacts as an antioxidant, energizes your skin and helps improves skin elasticity.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eHibiscus\u003c\/strong\u003e is a natural astringent rich in calcium, magnesium, and iron. A cooling and refreshing source of vegetable acids and vitamins A, B6, B12,, 12 C \u0026amp; D. Great for acne and oily combination skin.\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:33-04:00","created_at":"2017-06-01T21:34:06-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["probiotics"],"price":2499,"price_min":2499,"price_max":2499,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40244950211,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15388612362288,"product_id":10471658243,"position":1,"created_at":"2020-07-16T07:34:52-04:00","updated_at":"2020-07-16T07:34:54-04:00","alt":null,"width":934,"height":1064,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","variant_ids":[40244950211]},"available":true,"name":"JACQ'S Revitalizing Face Toner - 2oz","public_title":"2oz","options":["2oz"],"price":2499,"weight":85,"compare_at_price":null,"inventory_quantity":111,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":7562006659120,"position":1,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerfront.jpg?v=1594899294"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","options":["Size"],"media":[{"alt":null,"id":7562006659120,"position":1,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294"},"aspect_ratio":0.878,"height":1064,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","width":934},{"alt":null,"id":7562005446704,"position":2,"preview_image":{"aspect_ratio":0.871,"height":1070,"width":932,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerfront.jpg?v=1594899294"},"aspect_ratio":0.871,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerfront.jpg?v=1594899294","width":932}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eA\u003cstrong\u003e hydrating floral tea for your skin\u003c\/strong\u003e formulated with refreshing Mint, toning and moisturizing \u003cstrong\u003eHibiscus pedals and healing Burdock Root\u003c\/strong\u003e. A perfect blend of herbal extracts,\u003cstrong\u003e fatty acids, and vitamins\u003c\/strong\u003e, this toner was crafted to\u003cstrong\u003e restores skin pH balance. minimize the appearance of pores, tone and remove excess residue from makeup, dirt, and oils\u003c\/strong\u003e.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003eWater (Aqua), *Hibiscus Rosa Sinensis Linn (Hibiscus), *Mentha Citrus Sinensis (Orange Mint), Rosa Centifolia (Rose), *Prunus Amygdalus Dulcis (Sweet Almond) Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Arctium Lappa (Burdock) Extract, *Echinacea Purpurea Extract, *Rumex (Yellow Dock) Crispus Extract, *Chamomilla Recutita (Matricaria) Extract, *Rosa Moschata (Rosehip) Seed Oil, Hippophae Rhamnoides (Sea Buckthorn) Seed Oil, *Aloe Barbadensis Extract, Ubiquinone (CoQ10), Leucidal Liquid (Radish Root Ferment) and Pure Essential Oils . *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eAfter cleansing, moisten a cotton pad with the toner and gently wipe across the forehead, cheek, and throat in an upward with outward motions. Avoid eye area.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"color: #0b5394;\"\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003eBurdock Root \u003c\/b\u003econtains ingredients known for cleansing the lymphatic system. It's antifungal and antibacterial and an ideal ingredient for regulating oil production in the skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eCoQ10 \u003c\/b\u003eacts as an antioxidant, energizes your skin and helps improves skin elasticity.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eHibiscus\u003c\/strong\u003e is a natural astringent rich in calcium, magnesium, and iron. A cooling and refreshing source of vegetable acids and vitamins A, B6, B12,, 12 C \u0026amp; D. Great for acne and oily combination skin.\u003c\/li\u003e\n\u003c\/ul\u003e"}

JACQ'S Revitalizing Face Toner

$ 24.99
PRODUCT INFO INGREDIENTS HOW TO USE A hydrating floral tea for your skin formulated with refreshing Mint, toning and moisturizing Hibiscus pedals and healing Burdock Root. A perfect blend of herbal extracts, fatty acids, and vitamins, this toner was crafted to restores skin pH balance. minimize the appearance of pores,...
JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit
{"id":432966860829,"title":"JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit","handle":"heal-slay-kit-save-10","description":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Best-Selling Heal \u0026amp; Slay Vegan Skincare Trio: Face Cleanser, Toner, and Moisturizer\u003c\/span\u003e\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFORMATION\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHere's the perfect Heal and Slay Vegan Skincare Kit. This cruelty-free beauty kit contains our best sellers. Enjoy this magical trio including the JACQ's Healing Face Cleanser, Revitalizing Face Toner and Nourishing Face Moisturizer all work together to help you slay the day, that meeting, those exams or just to slay selfies. Slaying just got a lot easier!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e","published_at":"2017-07-11T19:04:06-04:00","created_at":"2018-03-08T15:45:59-05:00","vendor":"Jacq's Organics","type":"Gifts","tags":["bundle","coconut","CoQ10","face cleanser","face moisturizer","face toner","heal \u0026 slay kit","moringa","trio","yucca"],"price":7100,"price_min":7100,"price_max":7100,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":32324153049136,"title":"Full size","option1":"Full size","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit - Full size","public_title":"Full size","options":["Full size"],"price":7100,"weight":371,"compare_at_price":null,"inventory_quantity":164,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealandkitboxes.jpg?v=1649449002","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit.png?v=1649449002"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002","options":["Size:"],"media":[{"alt":null,"id":22002511708208,"position":1,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002","width":2048},{"alt":null,"id":21058647392304,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealandkitboxes.jpg?v=1649449002"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealandkitboxes.jpg?v=1649449002","width":937},{"alt":null,"id":21179951677488,"position":3,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit.png?v=1649449002"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit.png?v=1649449002","width":2048}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Best-Selling Heal \u0026amp; Slay Vegan Skincare Trio: Face Cleanser, Toner, and Moisturizer\u003c\/span\u003e\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFORMATION\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHere's the perfect Heal and Slay Vegan Skincare Kit. This cruelty-free beauty kit contains our best sellers. Enjoy this magical trio including the JACQ's Healing Face Cleanser, Revitalizing Face Toner and Nourishing Face Moisturizer all work together to help you slay the day, that meeting, those exams or just to slay selfies. Slaying just got a lot easier!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e"}

JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit

$ 71.00
JACQ's Best-Selling Heal & Slay Vegan Skincare Trio: Face Cleanser, Toner, and Moisturizer PRODUCT INFORMATION Here's the perfect Heal and Slay Vegan Skincare Kit. This cruelty-free beauty kit contains our best sellers. Enjoy this magical trio including the JACQ's Healing Face Cleanser, Revitalizing Face Toner and Nourishing Face Moisturizer all...
JACQ's calm & repair face serum JACQ's calm & repair face serum ingredients label
{"id":10500458115,"title":"JACQ'S Balancing Face Serum","handle":"balancing-face-serum","description":"\u003ch2\u003eVegan-Friendly Face Serum with vitamin boost\u003c\/h2\u003e\n\u003cp\u003e10 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThe root of a \u003cstrong\u003ecarrot contains 89% water.\u003c\/strong\u003e This magical plant is high in \u003cstrong\u003eBeta-carotene, Minerals and Vitamins A, B, C and E\u003c\/strong\u003e. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result is hydrating and supple skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Carthamus (Safflower) Tinctorius, *Rosa Canina (Rosehip) Seed Fruit Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Falcatum (Bupleurum) Root Extract, *Rumex (Yellow Dock) Crispus Extract, *Gentiana Lutea (Gentian) Root Extract, *Aloe Barbadensis Extract, Glycerin, Hippophae Rhamnoides (Sea Buckthorn Berry) CO2 extract, *Pelargonium (Rose Geranium) Graveolens Oil, *Ocimum Basillicum (Basil) Oil, Panthenol, Pure Essential Oils, Tocopherol (non-GM0) and Ferulic Acid. **Certified Organic Ingredient\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eA little goes a long way. Warm one to two drops between hands then gently press onto damp face, neck and decolletage.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e 20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e\n\u003ch3\u003e\n\u003cstrong\u003eKEY \u003c\/strong\u003e\u003cstrong\u003eINGREDIENTS\u003c\/strong\u003e FOR JACQ'S ORGANIC FACE SERUM\u003c\/h3\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003eCarrot\u003c\/strong\u003e is a natural source of beta-carotene, biotin and lycopene. Great for feeding skin antioxidants, cellular reproduction and improving skin texture.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Geranium\u003c\/strong\u003e is an aromatic, floral and sweet essential oil that's an ideal ingredient that \u003cspan\u003epromotes \u003c\/span\u003e\u003cem\u003eskin\u003c\/em\u003e\u003cspan\u003e cell renewal and ideal ingredient for all skin for every skin type.\u003c\/span\u003e \u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eFerulic Acid\u003c\/strong\u003e is a plant-based antioxidant with a rich source of Vitamin C \u0026amp; E. A beautiful ingredient known to naturally brighten skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRosehip Seed Oil\u003c\/strong\u003e is packed with vitamins, antioxidants and essential fatty acids that help combat uneven skin tone and fine lines. \u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-14T12:13:43-04:00","created_at":"2017-06-09T16:24:14-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["antiaging","beta carotene","carrot","face serum","ferulic acid","minerals","rosehip seed oil","vitamin A","Vitamin B","Vitamin C"],"price":1900,"price_min":1900,"price_max":6200,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636383363,"title":"1oz","option1":"1oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28643702669360,"product_id":10500458115,"position":4,"created_at":"2021-07-14T18:52:58-04:00","updated_at":"2021-07-14T18:52:58-04:00","alt":null,"width":553,"height":770,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/oils_2.jpg?v=1626303178","variant_ids":[40636383363]},"available":true,"name":"JACQ'S Balancing Face Serum - 1oz","public_title":"1oz","options":["1oz"],"price":6200,"weight":85,"compare_at_price":null,"inventory_quantity":159,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","featured_media":{"alt":null,"id":20906546233392,"position":4,"preview_image":{"aspect_ratio":0.718,"height":770,"width":553,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/oils_2.jpg?v=1626303178"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":31932473475120,"title":"5g","option1":"5g","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S Balancing Face Serum - 5g","public_title":"5g","options":["5g"],"price":1900,"weight":10,"compare_at_price":null,"inventory_quantity":288,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1608825416","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumback.jpg?v=1608825416","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs7gbalancingfaceserumfront.jpg?v=1608825416","\/\/\/s\/files\/1\/0877\/4074\/products\/oils_2.jpg?v=1626303178"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1608825416","options":["Size"],"media":[{"alt":"JACQ's calm \u0026 repair face serum","id":7561919660080,"position":1,"preview_image":{"aspect_ratio":0.881,"height":1063,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1608825416"},"aspect_ratio":0.881,"height":1063,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1608825416","width":937},{"alt":"JACQ's calm \u0026 repair face serum ingredients label","id":7561919627312,"position":2,"preview_image":{"aspect_ratio":0.873,"height":1070,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumback.jpg?v=1608825416"},"aspect_ratio":0.873,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumback.jpg?v=1608825416","width":934},{"alt":"JACQ's Balancing Face Serum ","id":7561935388720,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1073,"width":932,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs7gbalancingfaceserumfront.jpg?v=1608825416"},"aspect_ratio":0.869,"height":1073,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs7gbalancingfaceserumfront.jpg?v=1608825416","width":932},{"alt":null,"id":20906546233392,"position":4,"preview_image":{"aspect_ratio":0.718,"height":770,"width":553,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/oils_2.jpg?v=1626303178"},"aspect_ratio":0.718,"height":770,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/oils_2.jpg?v=1626303178","width":553}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eVegan-Friendly Face Serum with vitamin boost\u003c\/h2\u003e\n\u003cp\u003e10 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThe root of a \u003cstrong\u003ecarrot contains 89% water.\u003c\/strong\u003e This magical plant is high in \u003cstrong\u003eBeta-carotene, Minerals and Vitamins A, B, C and E\u003c\/strong\u003e. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result is hydrating and supple skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Carthamus (Safflower) Tinctorius, *Rosa Canina (Rosehip) Seed Fruit Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Falcatum (Bupleurum) Root Extract, *Rumex (Yellow Dock) Crispus Extract, *Gentiana Lutea (Gentian) Root Extract, *Aloe Barbadensis Extract, Glycerin, Hippophae Rhamnoides (Sea Buckthorn Berry) CO2 extract, *Pelargonium (Rose Geranium) Graveolens Oil, *Ocimum Basillicum (Basil) Oil, Panthenol, Pure Essential Oils, Tocopherol (non-GM0) and Ferulic Acid. **Certified Organic Ingredient\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eA little goes a long way. Warm one to two drops between hands then gently press onto damp face, neck and decolletage.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e 20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e\n\u003ch3\u003e\n\u003cstrong\u003eKEY \u003c\/strong\u003e\u003cstrong\u003eINGREDIENTS\u003c\/strong\u003e FOR JACQ'S ORGANIC FACE SERUM\u003c\/h3\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003eCarrot\u003c\/strong\u003e is a natural source of beta-carotene, biotin and lycopene. Great for feeding skin antioxidants, cellular reproduction and improving skin texture.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Geranium\u003c\/strong\u003e is an aromatic, floral and sweet essential oil that's an ideal ingredient that \u003cspan\u003epromotes \u003c\/span\u003e\u003cem\u003eskin\u003c\/em\u003e\u003cspan\u003e cell renewal and ideal ingredient for all skin for every skin type.\u003c\/span\u003e \u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eFerulic Acid\u003c\/strong\u003e is a plant-based antioxidant with a rich source of Vitamin C \u0026amp; E. A beautiful ingredient known to naturally brighten skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRosehip Seed Oil\u003c\/strong\u003e is packed with vitamins, antioxidants and essential fatty acids that help combat uneven skin tone and fine lines. \u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e"}

JACQ'S Balancing Face Serum

$ 19.00
Vegan-Friendly Face Serum with vitamin boost 10 ACTIVE INGREDIENTS PRODUCT INFO INGREDIENTS HOW TO USE The root of a carrot contains 89% water. This magical plant is high in Beta-carotene, Minerals and Vitamins A, B, C and E. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result...
{"id":10500480579,"title":"JACQ's PROBIOTIC FACE MASK","handle":"probiotic-face-mask-1","description":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:34-04:00","created_at":"2017-06-09T16:34:13-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","antioxidant","booster","Carrot","emollient","essential oils","Face Mask","face oil","face serum","jackfruit","moisturizer","papaya","protein","skin serum","vitamin E","yucca"],"price":2300,"price_min":2300,"price_max":2300,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636604483,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":29235789692976,"product_id":10500480579,"position":1,"created_at":"2021-12-15T14:18:06-05:00","updated_at":"2021-12-15T14:18:22-05:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902","variant_ids":[40636604483]},"available":true,"name":"JACQ's PROBIOTIC FACE MASK - 2oz","public_title":"2oz","options":["2oz"],"price":2300,"weight":85,"compare_at_price":null,"inventory_quantity":148,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21516283084848,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1639595902","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1639595902","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1639595902","\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsprobioticfacemask937x1075_efe4003d-666a-4729-8141-dcb8f6678803.jpg?v=1639595902"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902","options":["Size"],"media":[{"alt":null,"id":21516283084848,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902","width":937},{"alt":null,"id":21058609020976,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1639595902"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1639595902","width":937},{"alt":null,"id":21058585428016,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1639595902"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1639595902","width":937},{"alt":null,"id":21058608988208,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1639595902"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1639595902","width":937},{"alt":null,"id":21058594865200,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsprobioticfacemask937x1075_efe4003d-666a-4729-8141-dcb8f6678803.jpg?v=1639595902"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsprobioticfacemask937x1075_efe4003d-666a-4729-8141-dcb8f6678803.jpg?v=1639595902","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e"}


$ 23.00
JACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin PRODUCT INFO INGREDIENTS HOW TO USE Have faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. The natural Phytochemicals, Tri-Enzymes and Proteins beautifully works to quench and...
JACQ'S Operation Glow 4.0 Skincare Bundle JACQ'S Operation Glow 4.0 Skincare Bundle
{"id":10620931907,"title":"JACQ'S Operation Glow 4.0 Skincare Bundle","handle":"jacqs-operation-glow-skincare-kit","description":"\u003ch2\u003eJACQ's Skincare Bundle For All Skin Types, 6 products\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThe coalition effect, known as Operation Glow 4.0, benefits all skin types. all ages and myriad of dynamic women looking to restore her glow. This is the ultimate coalition force if you are looking for the ultimate glow. Armed with our decadent and moisturizing Antioxidant Beauty Balm that doubles as a cleanser and replenishes skin, followed by our Revitalizing Floral Face Toner that minimizes the appearance of pores, then reward your skin with our light-weight face serum that hydrates skin with potent plant nutrients. For that extra boost, layer on our Nourishing Face Moisturizer to reveal your best glow yet.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT YOU CAN EXPECT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e1 Replenishing Face Serum \u003c\/li\u003e\n\u003cli\u003e1 Healing Face Cleanser\u003c\/li\u003e\n\u003cli\u003e1 Revitalizing Face Toner \u003c\/li\u003e\n\u003cli\u003e1 Nourishing Face Moisturizer\u003c\/li\u003e\n\u003cli\u003e1 Antioxidant Beauty Balm \u003c\/li\u003e\n\u003cli\u003e1 Clarifying Face Masque \u0026amp; Scrub\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003ePackaged in a gift-ready box\u003cbr\u003e*See links for full list of ingredients, benefits, uses and directions++\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-11T19:05:40-04:00","created_at":"2017-07-11T06:01:51-04:00","vendor":"Jacq's Organics","type":"Gifts","tags":["beauty balm","bundle","face cleanser","Face Mask","face moisturizer","face serum","face toner","skincare bundle"],"price":22000,"price_min":22000,"price_max":22000,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42180577411,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S Operation Glow 4.0 Skincare Bundle","public_title":null,"options":["Default Title"],"price":22000,"weight":227,"compare_at_price":null,"inventory_quantity":266,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/","\/\/\/s\/files\/1\/0877\/4074\/products\/","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsoperationsglowset.jpg?v=1628545296"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/","options":["Title"],"media":[{"alt":null,"id":21058755625008,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/","width":937},{"alt":null,"id":21058756378672,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/","width":937},{"alt":"6 JACQ's skincare products, Operation Glow 4.0","id":7562730012720,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1071,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsoperationsglowset.jpg?v=1628545296"},"aspect_ratio":0.872,"height":1071,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsoperationsglowset.jpg?v=1628545296","width":934}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Skincare Bundle For All Skin Types, 6 products\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThe coalition effect, known as Operation Glow 4.0, benefits all skin types. all ages and myriad of dynamic women looking to restore her glow. This is the ultimate coalition force if you are looking for the ultimate glow. Armed with our decadent and moisturizing Antioxidant Beauty Balm that doubles as a cleanser and replenishes skin, followed by our Revitalizing Floral Face Toner that minimizes the appearance of pores, then reward your skin with our light-weight face serum that hydrates skin with potent plant nutrients. For that extra boost, layer on our Nourishing Face Moisturizer to reveal your best glow yet.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT YOU CAN EXPECT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e1 Replenishing Face Serum \u003c\/li\u003e\n\u003cli\u003e1 Healing Face Cleanser\u003c\/li\u003e\n\u003cli\u003e1 Revitalizing Face Toner \u003c\/li\u003e\n\u003cli\u003e1 Nourishing Face Moisturizer\u003c\/li\u003e\n\u003cli\u003e1 Antioxidant Beauty Balm \u003c\/li\u003e\n\u003cli\u003e1 Clarifying Face Masque \u0026amp; Scrub\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003ePackaged in a gift-ready box\u003cbr\u003e*See links for full list of ingredients, benefits, uses and directions++\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e"}

JACQ'S Operation Glow 4.0 Skincare Bundle

$ 220.00
JACQ's Skincare Bundle For All Skin Types, 6 products PRODUCT INFO The coalition effect, known as Operation Glow 4.0, benefits all skin types. all ages and myriad of dynamic women looking to restore her glow. This is the ultimate coalition force if you are looking for the ultimate glow. Armed...
JACQ's Moisturizing Antioxidant Beauty Balm JACQ's Moisturizing Antioxidant Beauty Balm
{"id":10500471235,"title":"JACQ's Moisturizing Antioxidant Beauty Balm","handle":"antioxidant-infused-beauty-balm","description":"\u003ch2\u003eJACQ's Organic Balm Cleanser and Moisturizer with Jackfruit \u0026amp; Vanilla Extract\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\n\u003cp\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/p\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eJACQ's organic moisturizing balm starts here. This waterless balm works as a hydrating cleanser and a moisturizer. Enriched with a potent blend of emollients and a powerhouse of Antioxidants including Jackfruit, Rosehip Seed Oil, and Vanilla Extracts. The decadent blend of delicious butter-infused with exotic plant oils melts away makeup, dirt, and debris after a long day or night. Use as a hydrating spa night treatment. \u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Carapa Guianensis (Andiroba) Nut Oil, *Butyrospermum (Shea Butter) Parkii Butter, Theobroma Cacao (Cocoa) Butter, *Vitis Vinifera (Grape) Seed Oil, Rosa Moschata (Rosehip) Seed Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Rumex (Yellow Dock) Crispus Extract, *Chamomilla (Chamomile) Recutita Matricaria Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, *Juniperus (Juniper) Communis Fruit Oil, Calophyllum (Tamanu) Tacamahaca Seed Oil, Pelargonium (Rose Geranium) Graveolens Oil, *Vanilla Planifolia (Vanilla) Fruit Extract, Pure Essential Oils and *Beta (Beet Root) Vulgaris Powder. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTO CLEANSE Warm a small amount in your hands and gently massage onto dry skin. Remove with a warm, damp cloth. TO MOISTURIZE Warm a 1\/2 pea-sized amount in your hands and apply to damp skin. A little goes a long way.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"aging,mature skin, purple balloon icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/AGING_AND_MATURE_ICON_JACQS_SKINCARE_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, bunny icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_compact.jpg?v=1517023823\"\u003e\n\u003c\/div\u003e\n\u003cstyle type=\"text\/css\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e","published_at":"2017-07-14T12:12:34-04:00","created_at":"2017-06-09T16:30:04-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["antioxidant","balm","beauty balm","cleanser","grape seed oil","jackfruit","moisturizer","shea butter","vanilla"],"price":4900,"price_min":4900,"price_max":4900,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636518147,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15389544022064,"product_id":10500471235,"position":2,"created_at":"2020-07-16T11:06:13-04:00","updated_at":"2021-08-09T17:40:22-04:00","alt":null,"width":935,"height":1070,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsantioxidantbeautybalm.jpg?v=1628545222","variant_ids":[40636518147]},"available":true,"name":"JACQ's Moisturizing Antioxidant Beauty Balm - 2oz","public_title":"2oz","options":["2oz"],"price":4900,"weight":170,"compare_at_price":null,"inventory_quantity":466,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":7562938679344,"position":2,"preview_image":{"aspect_ratio":0.874,"height":1070,"width":935,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsantioxidantbeautybalm.jpg?v=1628545222"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalmtexture937x1075_7ff8667d-0033-4438-951e-a546938c1695.jpg?v=1628545222","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsantioxidantbeautybalm.jpg?v=1628545222","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalm_6208fc5f-6dc5-43cd-bc14-2eb69982f24e.png?v=1628545222","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalm937x1075_daba1642-df83-4356-b811-7b903164b9d9.png?v=1628545137","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalmcleanser937x1075.png?v=1628545220"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalmtexture937x1075_7ff8667d-0033-4438-951e-a546938c1695.jpg?v=1628545222","options":["Size"],"media":[{"alt":null,"id":21058748317744,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalmtexture937x1075_7ff8667d-0033-4438-951e-a546938c1695.jpg?v=1628545222"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalmtexture937x1075_7ff8667d-0033-4438-951e-a546938c1695.jpg?v=1628545222","width":937},{"alt":null,"id":7562938679344,"position":2,"preview_image":{"aspect_ratio":0.874,"height":1070,"width":935,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsantioxidantbeautybalm.jpg?v=1628545222"},"aspect_ratio":0.874,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsantioxidantbeautybalm.jpg?v=1628545222","width":935},{"alt":null,"id":7584754335792,"position":3,"preview_image":{"aspect_ratio":0.874,"height":435,"width":380,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalm_6208fc5f-6dc5-43cd-bc14-2eb69982f24e.png?v=1628545222"},"aspect_ratio":0.874,"height":435,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalm_6208fc5f-6dc5-43cd-bc14-2eb69982f24e.png?v=1628545222","width":380},{"alt":null,"id":21058748481584,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalm937x1075_daba1642-df83-4356-b811-7b903164b9d9.png?v=1628545137"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalm937x1075_daba1642-df83-4356-b811-7b903164b9d9.png?v=1628545137","width":937},{"alt":null,"id":21058752380976,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalmcleanser937x1075.png?v=1628545220"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalmcleanser937x1075.png?v=1628545220","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Organic Balm Cleanser and Moisturizer with Jackfruit \u0026amp; Vanilla Extract\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\n\u003cp\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/p\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eJACQ's organic moisturizing balm starts here. This waterless balm works as a hydrating cleanser and a moisturizer. Enriched with a potent blend of emollients and a powerhouse of Antioxidants including Jackfruit, Rosehip Seed Oil, and Vanilla Extracts. The decadent blend of delicious butter-infused with exotic plant oils melts away makeup, dirt, and debris after a long day or night. Use as a hydrating spa night treatment. \u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Carapa Guianensis (Andiroba) Nut Oil, *Butyrospermum (Shea Butter) Parkii Butter, Theobroma Cacao (Cocoa) Butter, *Vitis Vinifera (Grape) Seed Oil, Rosa Moschata (Rosehip) Seed Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Rumex (Yellow Dock) Crispus Extract, *Chamomilla (Chamomile) Recutita Matricaria Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, *Juniperus (Juniper) Communis Fruit Oil, Calophyllum (Tamanu) Tacamahaca Seed Oil, Pelargonium (Rose Geranium) Graveolens Oil, *Vanilla Planifolia (Vanilla) Fruit Extract, Pure Essential Oils and *Beta (Beet Root) Vulgaris Powder. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTO CLEANSE Warm a small amount in your hands and gently massage onto dry skin. Remove with a warm, damp cloth. TO MOISTURIZE Warm a 1\/2 pea-sized amount in your hands and apply to damp skin. A little goes a long way.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"aging,mature skin, purple balloon icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/AGING_AND_MATURE_ICON_JACQS_SKINCARE_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, bunny icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_compact.jpg?v=1517023823\"\u003e\n\u003c\/div\u003e\n\u003cstyle type=\"text\/css\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e"}

JACQ's Moisturizing Antioxidant Beauty Balm

$ 49.00
JACQ's Organic Balm Cleanser and Moisturizer with Jackfruit & Vanilla Extract PRODUCT INFO INGREDIENTS HOW TO USE JACQ's organic moisturizing balm starts here. This waterless balm works as a hydrating cleanser and a moisturizer. Enriched with a potent blend of emollients and a powerhouse of Antioxidants including Jackfruit, Rosehip Seed Oil, and...
JACQ's Organic Bamboo Charcoal + Roses Detoxifying Bath Bomb Black
{"id":320367689757,"title":"JACQ's Bamboo Charcoal + Roses Detoxifying Bath Bomb","handle":"jacqs-skincare-bamboo-charcoal-bath-bomb","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Detoxifying Organic Bath Bomb with Bamboo Charcoal, Cocoa Butter, \u0026amp; Sea Salt\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT IS IT:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003eFor those that love JACQ's organic Green Smoothie Face Mask aka Clarifying Face Masque and Scrub, we've created a bath bomb that will allow you to indulge and detox. Hand-crafted with activated bamboo charcoal, sea salt to soak away the day and creamy cocoa butter to caress the skin while you soak.\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eBAMBOO CHARCOAL \u0026amp; ROSES BATH BOMB INGREDIENTS:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003eSodium bicarbonate, Citric acid, Theobroma Cacao (Cocoa) Seed Butter*, Magnesium (Sea Salt) Carbonate, Oats, Fragrance, Aloe Barbadensis (Aloe Vera) Extract, Activated Bamboo Charcoal, Rose petals, Pine Needle Essential oil, Ginger Essential oil, Orange Essential Oil and a proprietary blend.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cstrong\u003eHOW TO USE JACQ'S BATH BOMB: \u003c\/strong\u003eFill your bathtub with warm water, drop in the bath bomb and lie back to enjoy the aromatic essential oil blend and sea salt bath.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHO CAN USE IT:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: start;\"\u003e\u003cstrong\u003e\u003cimg style=\"float: none;\" alt=\"all skin types pink icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cem\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free icon, mouse icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MOUSE_small.jpg?v=1499297270\"\u003e\u003c\/em\u003e\u003cimg style=\"float: none;\" alt=\"handmade in small batches, unicorn icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\"\u003e\u003c\/strong\u003e\u003c\/div\u003e","published_at":"2017-11-10T09:32:01-05:00","created_at":"2017-11-27T22:52:00-05:00","vendor":"Jacq's Organics","type":"Bath \u0026 Body","tags":["ALOE","BATH BOMB","Subscription"],"price":700,"price_min":700,"price_max":1800,"available":true,"price_varies":true,"compare_at_price":2000,"compare_at_price_min":2000,"compare_at_price_max":2000,"compare_at_price_varies":false,"variants":[{"id":4771249291293,"title":"Set of 4","option1":"Set of 4","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Bamboo Charcoal + Roses Detoxifying Bath Bomb - Set of 4","public_title":"Set of 4","options":["Set of 4"],"price":1800,"weight":635,"compare_at_price":2000,"inventory_quantity":283,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]},{"id":4771249324061,"title":"Single","option1":"Single","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Bamboo Charcoal + Roses Detoxifying Bath Bomb - Single","public_title":"Single","options":["Single"],"price":700,"weight":168,"compare_at_price":null,"inventory_quantity":99,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_bath_bomb_jacqs_organics.jpg?v=1589145972"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_bath_bomb_jacqs_organics.jpg?v=1589145972","options":["Set"],"media":[{"alt":"JACQ's Organic Bamboo Charcoal + Roses Detoxifying Bath Bomb Black","id":801002651696,"position":1,"preview_image":{"aspect_ratio":1.0,"height":564,"width":564,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_bath_bomb_jacqs_organics.jpg?v=1589145972"},"aspect_ratio":1.0,"height":564,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_bath_bomb_jacqs_organics.jpg?v=1589145972","width":564}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Detoxifying Organic Bath Bomb with Bamboo Charcoal, Cocoa Butter, \u0026amp; Sea Salt\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT IS IT:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003eFor those that love JACQ's organic Green Smoothie Face Mask aka Clarifying Face Masque and Scrub, we've created a bath bomb that will allow you to indulge and detox. Hand-crafted with activated bamboo charcoal, sea salt to soak away the day and creamy cocoa butter to caress the skin while you soak.\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eBAMBOO CHARCOAL \u0026amp; ROSES BATH BOMB INGREDIENTS:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003eSodium bicarbonate, Citric acid, Theobroma Cacao (Cocoa) Seed Butter*, Magnesium (Sea Salt) Carbonate, Oats, Fragrance, Aloe Barbadensis (Aloe Vera) Extract, Activated Bamboo Charcoal, Rose petals, Pine Needle Essential oil, Ginger Essential oil, Orange Essential Oil and a proprietary blend.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cstrong\u003eHOW TO USE JACQ'S BATH BOMB: \u003c\/strong\u003eFill your bathtub with warm water, drop in the bath bomb and lie back to enjoy the aromatic essential oil blend and sea salt bath.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHO CAN USE IT:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: start;\"\u003e\u003cstrong\u003e\u003cimg style=\"float: none;\" alt=\"all skin types pink icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cem\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free icon, mouse icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MOUSE_small.jpg?v=1499297270\"\u003e\u003c\/em\u003e\u003cimg style=\"float: none;\" alt=\"handmade in small batches, unicorn icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\"\u003e\u003c\/strong\u003e\u003c\/div\u003e"}

JACQ's Bamboo Charcoal + Roses Detoxifying Bath Bomb

$ 18.00 $ 20.00
JACQ's Detoxifying Organic Bath Bomb with Bamboo Charcoal, Cocoa Butter, & Sea Salt WHAT IS IT: For those that love JACQ's organic Green Smoothie Face Mask aka Clarifying Face Masque and Scrub, we've created a bath bomb that will allow you to indulge and detox. Hand-crafted with activated bamboo charcoal, sea...
{"id":6547807830064,"title":"JACQ'S EASY PEASEY SKINCARE SLAY KIT","handle":"jacqs-easy-peasey-skincare-slay-kit","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eGet your self-care on, sis!  Indulge and enjoy a session of masking, messy bun, and a delicious moisturizer, lol.  The Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary, and papaya extract. While the Clarifying Face Masque \u0026amp; Scrub detoxifies your skin and feeds it minerals and active ingredients. Bring it all together with our delicious peptide-packed Nourishing Face Moisturizer to seal in all the moisture and restore that glow! Perfect for the skincare junkie and the lazy skincare queens.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"all skin types, pink icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cstrong\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" alt=\"Vegan-friendly, bird icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" alt=\"Cruelty-free, monkey icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" alt=\"organic ingredients, leaf icon\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e","published_at":"2021-03-17T16:31:19-04:00","created_at":"2021-03-17T16:01:37-04:00","vendor":"Jacq's Organics","type":"Gifts","tags":["beauty balm","bundle","cleanser","Face Mask","face scrub","face toner","gift set","skincare"],"price":7000,"price_min":7000,"price_max":7000,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39334934806576,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S EASY PEASEY SKINCARE SLAY KIT","public_title":null,"options":["Default Title"],"price":7000,"weight":454,"compare_at_price":null,"inventory_quantity":68,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareeasypeasy2048x2048.png?v=1649449639","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealingfacecleanserandclarifyingfacemask937x1075.jpg?v=1649449639","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075.jpg?v=1649449639"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareeasypeasy2048x2048.png?v=1649449639","options":["Title"],"media":[{"alt":null,"id":22002555289648,"position":1,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareeasypeasy2048x2048.png?v=1649449639"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareeasypeasy2048x2048.png?v=1649449639","width":2048},{"alt":null,"id":21058657419312,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealingfacecleanserandclarifyingfacemask937x1075.jpg?v=1649449639"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealingfacecleanserandclarifyingfacemask937x1075.jpg?v=1649449639","width":937},{"alt":null,"id":21058657517616,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075.jpg?v=1649449639"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075.jpg?v=1649449639","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eGet your self-care on, sis!  Indulge and enjoy a session of masking, messy bun, and a delicious moisturizer, lol.  The Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary, and papaya extract. While the Clarifying Face Masque \u0026amp; Scrub detoxifies your skin and feeds it minerals and active ingredients. Bring it all together with our delicious peptide-packed Nourishing Face Moisturizer to seal in all the moisture and restore that glow! Perfect for the skincare junkie and the lazy skincare queens.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"all skin types, pink icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cstrong\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" alt=\"Vegan-friendly, bird icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" alt=\"Cruelty-free, monkey icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" alt=\"organic ingredients, leaf icon\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e"}


$ 70.00
JACQ's Vegan-Friendly Skincare Kit for All Skin Types WHAT IT IS: Get your self-care on, sis!  Indulge and enjoy a session of masking, messy bun, and a delicious moisturizer, lol.  The Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary, and papaya extract. While the Clarifying Face Masque...
Showing items 1 - 10 of 10
We use cookies to improve our website and your shopping experience.By continuing to browse our site, you are consenting to our use of cookies. Read more about our Privacy Policy