Normal Skin

16 items
New Arrivals
Picked just for you.
Start shopping now.
JACQ's Beta-Acid Acne Treatment JACQ's Beta-Acid Acne Treatment
{"id":10500476675,"title":"JACQ's Beta-Acid Acne Treatment","handle":"the-high-priestess-beauty-booster","description":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-06-09T16:32:27-04:00","vendor":"JACQ'S","type":"Skin Care","tags":[],"price":1900,"price_min":1900,"price_max":1900,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636551619,"title":"1\/2 oz","option1":"1\/2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793009504304,"product_id":10500476675,"position":3,"created_at":"2021-08-09T15:23:56-04:00","updated_at":"2021-08-09T15:49:07-04:00","alt":null,"width":934,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","variant_ids":[40636551619]},"available":true,"name":"JACQ's Beta-Acid Acne Treatment - 1\/2 oz","public_title":"1\/2 oz","options":["1\/2 oz"],"price":1900,"weight":5,"compare_at_price":null,"inventory_quantity":131,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","options":["Size"],"media":[{"alt":null,"id":21058558591024,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058521497648,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"},"aspect_ratio":0.869,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","width":934},{"alt":null,"id":21058521464880,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e"}
{"id":10500480579,"title":"JACQ's PROBIOTIC FACE MASK","handle":"probiotic-face-mask-1","description":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:34-04:00","created_at":"2017-06-09T16:34:13-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","antioxidant","booster","Carrot","emollient","essential oils","Face Mask","face oil","face serum","jackfruit","moisturizer","papaya","protein","skin serum","vitamin E","yucca"],"price":2300,"price_min":2300,"price_max":2300,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636604483,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":29235789692976,"product_id":10500480579,"position":2,"created_at":"2021-12-15T14:18:06-05:00","updated_at":"2022-07-07T16:10:34-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","variant_ids":[40636604483]},"available":true,"name":"JACQ's PROBIOTIC FACE MASK - 2oz","public_title":"2oz","options":["2oz"],"price":2300,"weight":85,"compare_at_price":null,"inventory_quantity":143,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21516283084848,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","options":["Size"],"media":[{"alt":null,"id":22439844610096,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","width":937},{"alt":null,"id":21516283084848,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","width":937},{"alt":null,"id":21058609020976,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634","width":937},{"alt":null,"id":21058585428016,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634","width":937},{"alt":null,"id":21058608988208,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634","width":937},{"alt":null,"id":22439843332144,"position":6,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's Drip Collection Skincare Bundle - Save $10
{"id":10612520899,"title":"JACQ's Drip Collection Skincare Bundle - Save $10","handle":"beauty-boosting-trio","description":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-11T19:04:44-04:00","created_at":"2017-07-09T17:02:19-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","beauty booster","booster","chamomile","face oil","face serum","moringa","protein","protein booster","skin serum","yucca"],"price":6500,"price_min":6500,"price_max":6500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42098492355,"title":"1","option1":"1","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793140805680,"product_id":10612520899,"position":1,"created_at":"2021-08-09T16:36:51-04:00","updated_at":"2021-08-09T16:39:03-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","variant_ids":[42098492355]},"available":true,"name":"JACQ's Drip Collection Skincare Bundle - Save $10 - 1","public_title":"1","options":["1"],"price":6500,"weight":5,"compare_at_price":null,"inventory_quantity":244,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","options":["1 Pack"],"media":[{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's Restorative Face Serum JACQ's Restorative Face Serum
{"id":10636301379,"title":"JACQ's Restorative Face Serum","handle":"jacqs-restorative-face-serum","description":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-07-14T13:01:45-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["amino acids","booster","chamomile","hibiscus","Moringa","plant nutrients","Vitamin A","Vitamin D"],"price":2400,"price_min":2400,"price_max":2400,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42338644867,"title":"1oz","option1":"1oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793074614320,"product_id":10636301379,"position":1,"created_at":"2021-08-09T16:11:09-04:00","updated_at":"2021-08-09T17:44:38-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","variant_ids":[42338644867]},"available":true,"name":"JACQ's Restorative Face Serum - 1oz","public_title":"1oz","options":["1oz"],"price":2400,"weight":5,"compare_at_price":null,"inventory_quantity":37,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","options":["Size"],"media":[{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","width":937},{"alt":null,"id":21058578481200,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","width":937},{"alt":null,"id":21058578513968,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","width":937},{"alt":null,"id":21058578546736,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e"}
JACQ's Healing Face Cleanser JACQ's Healing Face Cleanser
{"id":10500323523,"title":"JACQ's Healing Face Cleanser","handle":"healing-face-cleanser","description":"\u003ch3\u003e\u003c\/h3\u003e\n\u003ch2\u003eJACQ's Vegan, Cruelty-free Face Cleanser with Papaya \u0026amp; Moringa Extract\u003c\/h2\u003e\n\u003ch3\u003eFace Cleanser for Oily \u0026amp; Combination Skin \u003c\/h3\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003e\n\u003cspan\u003eA game-changing face cleanser that \u003c\/span\u003e\u003cstrong\u003edissolves dirt, makeup, and impurities on the skin.\u003c\/strong\u003e\u003cspan\u003e Creamy in texture, pink in color this cleanser is formulated with rich \u003c\/span\u003e\u003cstrong\u003eAmino Acids, Fruit Enzymes\u003c\/strong\u003e\u003cspan\u003e found in \u003c\/span\u003e\u003cstrong\u003ePapaya Extract\u003c\/strong\u003e\u003cspan\u003e to gently remove dead cells. Skin conditioning \u003c\/span\u003e\u003cstrong\u003eVitamin B3\u003c\/strong\u003e\u003cspan\u003e and healing \u003c\/span\u003e\u003cstrong\u003eMoringa Extract\u003c\/strong\u003e\u003cspan\u003e all work together to leave skin feeling clean and refreshed.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e\u003cspan\u003eWater (Aqua), *Helianthus Annuus (Sunflower) Seed Oil, *Cocos Nucifera (Coconut) Oil, *Ricinus Communis (Castor) Seed Oil, , Potassium hydroxide, *Glycerin, *Citric acid, Moringa Oleifera Seed Extract, Carica Papaya (Papaya) Fruit Extract, Spearmint Oil, Eucalyptus Oil, Peppermint Oil, Ginger Oil, Pure Essential Oils and Kaolinite (Rose Clay). *Certified Organic\u003c\/span\u003e\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cspan\u003eMassage onto wet skin, work into a lather, inhale the aroma and rinse. Avoid eye area.\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003ch2\u003e\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003ePapaya \u003c\/b\u003ehigh in Vitamin A \u0026amp; E, omega-fatty acids, and papain enzymes. Papain enzymes work to gently exfoliate the skin while removing dead skin cells.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eMoringa \u003c\/b\u003eis a rich source of fatty acids great for nourishing the skin. It easily absorbs into skin, a powerful plant that fights inflammation and helps protect against free-radical damage.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Clay\u003c\/strong\u003e easily \u003cspan\u003eabsorb impurities from the\u003cstrong\u003e \u003c\/strong\u003e\u003c\/span\u003eskin\u003cspan\u003e, such as dirt, makeup, and oils.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\"\u003e\u003c\/strong\u003e\u003c\/p\u003e","published_at":"2017-07-14T12:13:43-04:00","created_at":"2017-06-09T14:55:17-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":[],"price":1100,"price_min":1100,"price_max":2400,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40633316483,"title":"4oz","option1":"4oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793182748720,"product_id":10500323523,"position":3,"created_at":"2021-08-09T17:15:55-04:00","updated_at":"2021-09-23T12:42:11-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_healing_face_cleanser_937x1075_dc2fbfe9-bc58-4d31-a8d7-fece0f081e01.jpg?v=1632415331","variant_ids":[40633316483]},"available":true,"name":"JACQ's Healing Face Cleanser - 4oz","public_title":"4oz","options":["4oz"],"price":2400,"weight":198,"compare_at_price":null,"inventory_quantity":405,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","featured_media":{"alt":null,"id":21058696282160,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_healing_face_cleanser_937x1075_dc2fbfe9-bc58-4d31-a8d7-fece0f081e01.jpg?v=1632415331"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":22497980317744,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15388578578480,"product_id":10500323523,"position":6,"created_at":"2020-07-16T07:28:45-04:00","updated_at":"2021-09-23T12:42:11-04:00","alt":null,"width":934,"height":1064,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront.jpg?v=1632415331","variant_ids":[22497980317744]},"available":true,"name":"JACQ's Healing Face Cleanser - 2oz","public_title":"2oz","options":["2oz"],"price":1100,"weight":57,"compare_at_price":null,"inventory_quantity":211,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","featured_media":{"alt":null,"id":7561972908080,"position":6,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront.jpg?v=1632415331"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JACQShealingfacemask937x1075f.jpg?v=1632415331","\/\/\/s\/files\/1\/0877\/4074\/products\/healingcleanser4ozrenderingfront.jpg?v=1632415331","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_healing_face_cleanser_937x1075_dc2fbfe9-bc58-4d31-a8d7-fece0f081e01.jpg?v=1632415331","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealingfacecleanser.png?v=1632415316","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQS_HEALING_FACE_CLEANSER_2_OZ_937X1075_c04780c2-6163-4953-8d10-137ebb71c5a5.jpg?v=1632415331","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront.jpg?v=1632415331"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JACQShealingfacemask937x1075f.jpg?v=1632415331","options":["Size"],"media":[{"alt":null,"id":21058703982640,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQShealingfacemask937x1075f.jpg?v=1632415331"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQShealingfacemask937x1075f.jpg?v=1632415331","width":937},{"alt":null,"id":20697463324720,"position":2,"preview_image":{"aspect_ratio":0.791,"height":1069,"width":846,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/healingcleanser4ozrenderingfront.jpg?v=1632415331"},"aspect_ratio":0.791,"height":1069,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/healingcleanser4ozrenderingfront.jpg?v=1632415331","width":846},{"alt":null,"id":21058696282160,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_healing_face_cleanser_937x1075_dc2fbfe9-bc58-4d31-a8d7-fece0f081e01.jpg?v=1632415331"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_healing_face_cleanser_937x1075_dc2fbfe9-bc58-4d31-a8d7-fece0f081e01.jpg?v=1632415331","width":937},{"alt":null,"id":21179935129648,"position":4,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealingfacecleanser.png?v=1632415316"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealingfacecleanser.png?v=1632415316","width":2048},{"alt":null,"id":21058696806448,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQS_HEALING_FACE_CLEANSER_2_OZ_937X1075_c04780c2-6163-4953-8d10-137ebb71c5a5.jpg?v=1632415331"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQS_HEALING_FACE_CLEANSER_2_OZ_937X1075_c04780c2-6163-4953-8d10-137ebb71c5a5.jpg?v=1632415331","width":937},{"alt":null,"id":7561972908080,"position":6,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront.jpg?v=1632415331"},"aspect_ratio":0.878,"height":1064,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront.jpg?v=1632415331","width":934}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch3\u003e\u003c\/h3\u003e\n\u003ch2\u003eJACQ's Vegan, Cruelty-free Face Cleanser with Papaya \u0026amp; Moringa Extract\u003c\/h2\u003e\n\u003ch3\u003eFace Cleanser for Oily \u0026amp; Combination Skin \u003c\/h3\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003e\n\u003cspan\u003eA game-changing face cleanser that \u003c\/span\u003e\u003cstrong\u003edissolves dirt, makeup, and impurities on the skin.\u003c\/strong\u003e\u003cspan\u003e Creamy in texture, pink in color this cleanser is formulated with rich \u003c\/span\u003e\u003cstrong\u003eAmino Acids, Fruit Enzymes\u003c\/strong\u003e\u003cspan\u003e found in \u003c\/span\u003e\u003cstrong\u003ePapaya Extract\u003c\/strong\u003e\u003cspan\u003e to gently remove dead cells. Skin conditioning \u003c\/span\u003e\u003cstrong\u003eVitamin B3\u003c\/strong\u003e\u003cspan\u003e and healing \u003c\/span\u003e\u003cstrong\u003eMoringa Extract\u003c\/strong\u003e\u003cspan\u003e all work together to leave skin feeling clean and refreshed.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e\u003cspan\u003eWater (Aqua), *Helianthus Annuus (Sunflower) Seed Oil, *Cocos Nucifera (Coconut) Oil, *Ricinus Communis (Castor) Seed Oil, , Potassium hydroxide, *Glycerin, *Citric acid, Moringa Oleifera Seed Extract, Carica Papaya (Papaya) Fruit Extract, Spearmint Oil, Eucalyptus Oil, Peppermint Oil, Ginger Oil, Pure Essential Oils and Kaolinite (Rose Clay). *Certified Organic\u003c\/span\u003e\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cspan\u003eMassage onto wet skin, work into a lather, inhale the aroma and rinse. Avoid eye area.\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003ch2\u003e\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003ePapaya \u003c\/b\u003ehigh in Vitamin A \u0026amp; E, omega-fatty acids, and papain enzymes. Papain enzymes work to gently exfoliate the skin while removing dead skin cells.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eMoringa \u003c\/b\u003eis a rich source of fatty acids great for nourishing the skin. It easily absorbs into skin, a powerful plant that fights inflammation and helps protect against free-radical damage.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Clay\u003c\/strong\u003e easily \u003cspan\u003eabsorb impurities from the\u003cstrong\u003e \u003c\/strong\u003e\u003c\/span\u003eskin\u003cspan\u003e, such as dirt, makeup, and oils.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\"\u003e\u003c\/strong\u003e\u003c\/p\u003e"}

JACQ's Healing Face Cleanser

$ 11.00
JACQ's Vegan, Cruelty-free Face Cleanser with Papaya & Moringa Extract Face Cleanser for Oily & Combination Skin  PRODUCT INFO INGREDIENTS HOW TO USE A game-changing face cleanser that dissolves dirt, makeup, and impurities on the skin. Creamy in texture, pink in color this cleanser is formulated with rich Amino Acids, Fruit Enzymes found in Papaya Extract to...
JACQ's Nourishing Lightweight Face Moisturizer JACQ's nourishing face moisturizer, pink packaging, clear bottle
{"id":10500456259,"title":"JACQ's Nourishing Lightweight Face Moisturizer","handle":"nourishing-face-moisturizer","description":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Organic Hydrating \u0026amp; Tightening Face Moisturizer with Vitamin C \u0026amp; Vitamin E\u003c\/span\u003e\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThis \u003cstrong\u003efast-absorbing light-weight moisturizer\u003c\/strong\u003e delivers a nourishing dose of \u003cstrong\u003epeptides, fatty acids\u003c\/strong\u003e and potent herbal extracts that will leave your skin \u003cstrong\u003erefreshed and hydrated\u003c\/strong\u003e. This nourishing blend of potent roots, an antioxidant cocktail of Vitamins C \u0026amp; E and hydrating Glycerin ties in this soothing formulation. \u003cstrong\u003ePlus it's a build-a-able moisturizer.\u003c\/strong\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003eWater (Aqua), Helianthus Annuus (Sunflower) Seed Oil*, Cocos Nucifera (Coconut) Oil*, Leucidal Bioferment (Radish Root) Extract, Xatham Gum (Non-GMO)*, Vegetable Glycerin (Non-GMO), Glauca (Yucca) Extract, Achillea Millefolium (Yarrow) Extract*, *Daucus Carota Sativa (Carrot) Root Extract*, Echinacea Purpurea Extract*, Arctium Lappa (Burdock) Extract*, Rumex (Yellow Dock) Crispus Extract*, Chamomilla Recutita (Matricaria) Flower Extract*, Panthenol, Squalane (Olive Derived), Rosa Rubiginosa (Rosehip) Seed Oil*, Ferulic Acid, Vitamin E (Non-GMO) and Pure Essential Oils . *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eGently press 2 to 3 drops onto face, neck, and décolleté morning and night.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003ch4\u003e\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\u003c\/h4\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003e Yucca\u003c\/b\u003e is a skin moisturizing root that contains resveratrol, a potent antioxidant known for it's healing properties. It also promotes new cell growth and an ideal ingredient for sensitive and aging skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eCoconut\u003c\/strong\u003e is a hydrating emollient rich in lauric acid and Vitamin E\u003cb\u003e. \u003c\/b\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eVitamin B5 \u003c\/b\u003eis hydrating and skin conditioning. It helps improve the appearance of skin texture and regenerates skin.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"Vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003cimg alt=\"cruelty-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e","published_at":"2017-07-14T12:12:33-04:00","created_at":"2017-06-09T16:23:08-04:00","vendor":"Jacq's Organics","type":"Face","tags":["active ingredients","antioxidant","coconut","face moisturizer","glycerin","lightweight","meta-related-femmecollection","moisturizer","probiotics","rose hip seed oil","vitamin B5","vitamin C","vitamin E","yucca"],"price":2800,"price_min":2800,"price_max":2800,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636345475,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15388635856944,"product_id":10500456259,"position":2,"created_at":"2020-07-16T07:38:59-04:00","updated_at":"2022-07-07T18:32:39-04:00","alt":"JACQ's nourishing face moisturizer, pink packaging, clear bottle","width":937,"height":1065,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerfront.jpg?v=1657233159","variant_ids":[40636345475]},"available":true,"name":"JACQ's Nourishing Lightweight Face Moisturizer - 2oz","public_title":"2oz","options":["2oz"],"price":2800,"weight":85,"compare_at_price":null,"inventory_quantity":78,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":"JACQ's nourishing face moisturizer, pink packaging, clear bottle","id":7562030284848,"position":2,"preview_image":{"aspect_ratio":0.88,"height":1065,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerfront.jpg?v=1657233159"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsNourishingFaceMoisturizer937x1075.png?v=1657233159","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerfront.jpg?v=1657233159","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075_12b81f59-8e5d-4fb3-ab43-e6879a679e46.jpg?v=1657233159","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofnourishingfacemoisturizer.png?v=1657233159","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerback.jpg?v=1657233159"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsNourishingFaceMoisturizer937x1075.png?v=1657233159","options":["Size"],"media":[{"alt":null,"id":22440652341296,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsNourishingFaceMoisturizer937x1075.png?v=1657233159"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsNourishingFaceMoisturizer937x1075.png?v=1657233159","width":937},{"alt":"JACQ's nourishing face moisturizer, pink packaging, clear bottle","id":7562030284848,"position":2,"preview_image":{"aspect_ratio":0.88,"height":1065,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerfront.jpg?v=1657233159"},"aspect_ratio":0.88,"height":1065,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerfront.jpg?v=1657233159","width":937},{"alt":null,"id":21058733834288,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075_12b81f59-8e5d-4fb3-ab43-e6879a679e46.jpg?v=1657233159"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075_12b81f59-8e5d-4fb3-ab43-e6879a679e46.jpg?v=1657233159","width":937},{"alt":null,"id":21180031926320,"position":4,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofnourishingfacemoisturizer.png?v=1657233159"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofnourishingfacemoisturizer.png?v=1657233159","width":2048},{"alt":"JACQ's nourishing lightweight face moisturizer ingredients","id":7562030252080,"position":5,"preview_image":{"aspect_ratio":0.87,"height":1073,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerback.jpg?v=1657233159"},"aspect_ratio":0.87,"height":1073,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizerback.jpg?v=1657233159","width":934}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Organic Hydrating \u0026amp; Tightening Face Moisturizer with Vitamin C \u0026amp; Vitamin E\u003c\/span\u003e\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThis \u003cstrong\u003efast-absorbing light-weight moisturizer\u003c\/strong\u003e delivers a nourishing dose of \u003cstrong\u003epeptides, fatty acids\u003c\/strong\u003e and potent herbal extracts that will leave your skin \u003cstrong\u003erefreshed and hydrated\u003c\/strong\u003e. This nourishing blend of potent roots, an antioxidant cocktail of Vitamins C \u0026amp; E and hydrating Glycerin ties in this soothing formulation. \u003cstrong\u003ePlus it's a build-a-able moisturizer.\u003c\/strong\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003eWater (Aqua), Helianthus Annuus (Sunflower) Seed Oil*, Cocos Nucifera (Coconut) Oil*, Leucidal Bioferment (Radish Root) Extract, Xatham Gum (Non-GMO)*, Vegetable Glycerin (Non-GMO), Glauca (Yucca) Extract, Achillea Millefolium (Yarrow) Extract*, *Daucus Carota Sativa (Carrot) Root Extract*, Echinacea Purpurea Extract*, Arctium Lappa (Burdock) Extract*, Rumex (Yellow Dock) Crispus Extract*, Chamomilla Recutita (Matricaria) Flower Extract*, Panthenol, Squalane (Olive Derived), Rosa Rubiginosa (Rosehip) Seed Oil*, Ferulic Acid, Vitamin E (Non-GMO) and Pure Essential Oils . *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eGently press 2 to 3 drops onto face, neck, and décolleté morning and night.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003ch4\u003e\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\u003c\/h4\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003e Yucca\u003c\/b\u003e is a skin moisturizing root that contains resveratrol, a potent antioxidant known for it's healing properties. It also promotes new cell growth and an ideal ingredient for sensitive and aging skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eCoconut\u003c\/strong\u003e is a hydrating emollient rich in lauric acid and Vitamin E\u003cb\u003e. \u003c\/b\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eVitamin B5 \u003c\/b\u003eis hydrating and skin conditioning. It helps improve the appearance of skin texture and regenerates skin.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"Vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003cimg alt=\"cruelty-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e"}

JACQ's Nourishing Lightweight Face Moisturizer

$ 28.00
JACQ's Organic Hydrating & Tightening Face Moisturizer with Vitamin C & Vitamin E PRODUCT INFO INGREDIENTS HOW TO USE This fast-absorbing light-weight moisturizer delivers a nourishing dose of peptides, fatty acids and potent herbal extracts that will leave your skin refreshed and hydrated. This nourishing blend of potent roots, an...
JACQ's Detox and Glow Vegan Skincare Kit
{"id":10620877315,"title":"JACQ's Detox and Glow Vegan Skincare Kit","handle":"jacqs-detox-and-glow-vegan-skincare-kit","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eHere's your weekend detox and glow set. \u003c\/strong\u003eFor the days or night's when you just want to put on a mask and put your hair in a bun. \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/healing-face-cleanser-2\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Healing Face Cleanser\"\u003eHealing Face Cleanser\u003c\/a\u003e refreshes and purifies the skin with \u003cstrong\u003epeppermint, rosemary and papaya extract\u003c\/strong\u003e. While the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/clarifying-masque-and-scrub\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Clarifying Masque \u0026amp; Face Scrub\"\u003eClarifying Face Masque \u0026amp; Scrub \u003c\/a\u003edetoxifies your skin and feeds it \u003cstrong\u003eminerals and active ingredients\u003c\/strong\u003e. Spritz the cooling and refreshing\u003ca href=\"https:\/\/\/collections\/skin-care\/products\/revitalizing-face-toner-1\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's revitalizing toner \"\u003e Revitalizing Face Toner\u003c\/a\u003e enriched with \u003cstrong\u003eCoQ10\u003c\/strong\u003e to help minimize the appearance of pores then restore your glow with the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/antioxidant-infused-beauty-balm\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Moisturizing Antioxidant Beauty Balm\"\u003eMoisturizing Antioxidant Beauty Balm \u003c\/a\u003ethat nourishes and replenishes.\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"Vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" style=\"float: none;\"\u003e\u003cimg alt=\"Cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e","published_at":"2017-07-11T19:04:05-04:00","created_at":"2017-07-11T05:23:22-04:00","vendor":"Jacq's Organics ","type":"Gifts","tags":["beauty balm","bundle","cleanser","Face Mask","face scrub","face toner","gift set","skincare"],"price":12800,"price_min":12800,"price_max":12800,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42178827523,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Detox and Glow Vegan Skincare Kit","public_title":null,"options":["Default Title"],"price":12800,"weight":454,"compare_at_price":null,"inventory_quantity":216,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsDetoxandGlowKit937x1075.png?v=1657227028"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsDetoxandGlowKit937x1075.png?v=1657227028","options":["Title"],"media":[{"alt":null,"id":22440058716208,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsDetoxandGlowKit937x1075.png?v=1657227028"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsDetoxandGlowKit937x1075.png?v=1657227028","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eHere's your weekend detox and glow set. \u003c\/strong\u003eFor the days or night's when you just want to put on a mask and put your hair in a bun. \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/healing-face-cleanser-2\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Healing Face Cleanser\"\u003eHealing Face Cleanser\u003c\/a\u003e refreshes and purifies the skin with \u003cstrong\u003epeppermint, rosemary and papaya extract\u003c\/strong\u003e. While the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/clarifying-masque-and-scrub\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Clarifying Masque \u0026amp; Face Scrub\"\u003eClarifying Face Masque \u0026amp; Scrub \u003c\/a\u003edetoxifies your skin and feeds it \u003cstrong\u003eminerals and active ingredients\u003c\/strong\u003e. Spritz the cooling and refreshing\u003ca href=\"https:\/\/\/collections\/skin-care\/products\/revitalizing-face-toner-1\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's revitalizing toner \"\u003e Revitalizing Face Toner\u003c\/a\u003e enriched with \u003cstrong\u003eCoQ10\u003c\/strong\u003e to help minimize the appearance of pores then restore your glow with the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/antioxidant-infused-beauty-balm\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Moisturizing Antioxidant Beauty Balm\"\u003eMoisturizing Antioxidant Beauty Balm \u003c\/a\u003ethat nourishes and replenishes.\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"Vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" style=\"float: none;\"\u003e\u003cimg alt=\"Cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e"}

JACQ's Detox and Glow Vegan Skincare Kit

$ 128.00
JACQ's Vegan-Friendly Skincare Kit for All Skin Types WHAT IT IS: Here's your weekend detox and glow set. For the days or night's when you just want to put on a mask and put your hair in a bun. Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary...
JACQ'S Balancing Face Serum JACQ's calm & repair face serum
{"id":10500458115,"title":"JACQ'S Balancing Face Serum","handle":"balancing-face-serum","description":"\u003ch2\u003eVegan-Friendly Face Serum with vitamin boost\u003c\/h2\u003e\n\u003cp\u003e10 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThe root of a \u003cstrong\u003ecarrot contains 89% water.\u003c\/strong\u003e This magical plant is high in \u003cstrong\u003eBeta-carotene, Minerals and Vitamins A, B, C and E\u003c\/strong\u003e. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result is hydrating and supple skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Carthamus (Safflower) Tinctorius, *Rosa Canina (Rosehip) Seed Fruit Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Falcatum (Bupleurum) Root Extract, *Rumex (Yellow Dock) Crispus Extract, *Gentiana Lutea (Gentian) Root Extract, *Aloe Barbadensis Extract, Glycerin, Hippophae Rhamnoides (Sea Buckthorn Berry) CO2 extract, *Pelargonium (Rose Geranium) Graveolens Oil, *Ocimum Basillicum (Basil) Oil, Panthenol, Pure Essential Oils, Tocopherol (non-GM0) and Ferulic Acid. **Certified Organic Ingredient\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eA little goes a long way. Warm one to two drops between hands then gently press onto damp face, neck and decolletage.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e 20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e\n\u003ch3\u003e\n\u003cstrong\u003eKEY \u003c\/strong\u003e\u003cstrong\u003eINGREDIENTS\u003c\/strong\u003e FOR JACQ'S ORGANIC FACE SERUM\u003c\/h3\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003eCarrot\u003c\/strong\u003e is a natural source of beta-carotene, biotin and lycopene. Great for feeding skin antioxidants, cellular reproduction and improving skin texture.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Geranium\u003c\/strong\u003e is an aromatic, floral and sweet essential oil that's an ideal ingredient that \u003cspan\u003epromotes \u003c\/span\u003e\u003cem\u003eskin\u003c\/em\u003e\u003cspan\u003e cell renewal and ideal ingredient for all skin for every skin type.\u003c\/span\u003e \u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eFerulic Acid\u003c\/strong\u003e is a plant-based antioxidant with a rich source of Vitamin C \u0026amp; E. A beautiful ingredient known to naturally brighten skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRosehip Seed Oil\u003c\/strong\u003e is packed with vitamins, antioxidants and essential fatty acids that help combat uneven skin tone and fine lines. \u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-14T12:13:43-04:00","created_at":"2017-06-09T16:24:14-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["antiaging","beta carotene","carrot","face serum","ferulic acid","minerals","rosehip seed oil","vitamin A","Vitamin B","Vitamin C"],"price":1900,"price_min":1900,"price_max":6200,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636383363,"title":"1oz","option1":"1oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S Balancing Face Serum - 1oz","public_title":"1oz","options":["1oz"],"price":6200,"weight":85,"compare_at_price":null,"inventory_quantity":150,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]},{"id":31932473475120,"title":"5g","option1":"5g","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S Balancing Face Serum - 5g","public_title":"5g","options":["5g"],"price":1900,"weight":10,"compare_at_price":null,"inventory_quantity":282,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum2937x1075.png?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumback.jpg?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs7gbalancingfaceserumfront.jpg?v=1657228018"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018","options":["Size"],"media":[{"alt":null,"id":22440135163952,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018","width":937},{"alt":"JACQ's calm \u0026 repair face serum","id":7561919660080,"position":2,"preview_image":{"aspect_ratio":0.881,"height":1063,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1657228018"},"aspect_ratio":0.881,"height":1063,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1657228018","width":937},{"alt":null,"id":22440140668976,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum2937x1075.png?v=1657228018"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum2937x1075.png?v=1657228018","width":937},{"alt":"JACQ's calm \u0026 repair face serum ingredients label","id":7561919627312,"position":4,"preview_image":{"aspect_ratio":0.873,"height":1070,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumback.jpg?v=1657228018"},"aspect_ratio":0.873,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumback.jpg?v=1657228018","width":934},{"alt":"JACQ's Balancing Face Serum ","id":7561935388720,"position":5,"preview_image":{"aspect_ratio":0.869,"height":1073,"width":932,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs7gbalancingfaceserumfront.jpg?v=1657228018"},"aspect_ratio":0.869,"height":1073,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs7gbalancingfaceserumfront.jpg?v=1657228018","width":932}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eVegan-Friendly Face Serum with vitamin boost\u003c\/h2\u003e\n\u003cp\u003e10 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThe root of a \u003cstrong\u003ecarrot contains 89% water.\u003c\/strong\u003e This magical plant is high in \u003cstrong\u003eBeta-carotene, Minerals and Vitamins A, B, C and E\u003c\/strong\u003e. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result is hydrating and supple skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Carthamus (Safflower) Tinctorius, *Rosa Canina (Rosehip) Seed Fruit Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Falcatum (Bupleurum) Root Extract, *Rumex (Yellow Dock) Crispus Extract, *Gentiana Lutea (Gentian) Root Extract, *Aloe Barbadensis Extract, Glycerin, Hippophae Rhamnoides (Sea Buckthorn Berry) CO2 extract, *Pelargonium (Rose Geranium) Graveolens Oil, *Ocimum Basillicum (Basil) Oil, Panthenol, Pure Essential Oils, Tocopherol (non-GM0) and Ferulic Acid. **Certified Organic Ingredient\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eA little goes a long way. Warm one to two drops between hands then gently press onto damp face, neck and decolletage.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e 20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e\n\u003ch3\u003e\n\u003cstrong\u003eKEY \u003c\/strong\u003e\u003cstrong\u003eINGREDIENTS\u003c\/strong\u003e FOR JACQ'S ORGANIC FACE SERUM\u003c\/h3\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003eCarrot\u003c\/strong\u003e is a natural source of beta-carotene, biotin and lycopene. Great for feeding skin antioxidants, cellular reproduction and improving skin texture.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Geranium\u003c\/strong\u003e is an aromatic, floral and sweet essential oil that's an ideal ingredient that \u003cspan\u003epromotes \u003c\/span\u003e\u003cem\u003eskin\u003c\/em\u003e\u003cspan\u003e cell renewal and ideal ingredient for all skin for every skin type.\u003c\/span\u003e \u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eFerulic Acid\u003c\/strong\u003e is a plant-based antioxidant with a rich source of Vitamin C \u0026amp; E. A beautiful ingredient known to naturally brighten skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRosehip Seed Oil\u003c\/strong\u003e is packed with vitamins, antioxidants and essential fatty acids that help combat uneven skin tone and fine lines. \u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e"}

JACQ'S Balancing Face Serum

$ 19.00
Vegan-Friendly Face Serum with vitamin boost 10 ACTIVE INGREDIENTS PRODUCT INFO INGREDIENTS HOW TO USE The root of a carrot contains 89% water. This magical plant is high in Beta-carotene, Minerals and Vitamins A, B, C and E. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result...
JACQ's Clarifying Green Smoothie Face Masque and Scrub JACQ's Clarifying Green Smoothie Face Masque and Scrub
{"id":10500475139,"title":"JACQ's Clarifying Green Smoothie Face Masque and Scrub","handle":"jacqs-clarifying-green-smoothie-face-mask-scrub","description":"\u003ch2\u003eJACQ's Green Smoothie Organic Face Mask \u0026amp; Scrub with Charcoal and Sea Salt\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eIt's all about the face mask. JACQ's Green Smoothie Face Masque and Scrub aka Clarifying Mask contains an abundance of Minerals, Botanical Peptides and Rich Clays that work to help get oxygen into skin cells. Our blend of Montmorillonite Clay, Activated Charcoal, and Dead Sea Salt paired together with olive-derived Squalane to draw out impurities while nourishing the skin. Protective Vitamin B3, the natural fruit acids extracts, and our proprietary essential oil blend leaves your skin feeling refreshed, cool and clean.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Rhassoul Clay (Moroccan Lava Clay), *Bentonite Clay, *Zea Mays (Corn) Starch, *Bamboo Activated Charcoal Powder, *Tapioca Starch, *Ascophyllum (Kelp Powder) Nodosum Powder, Calophyllum Inophyllum (Tamanu) Oil. Sodium Chloride (Dead Sea Salt), Niacinamide, Spearmint Oil, Lavender Oil, Rosmarinus Officinalis (Rosemary) Oil, Citrus Limonium (Lemon) Oil, Galangal Extract and Pure Essential Oils. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e45ML - Mix 1\/4 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation. 20ML - Mix 1\/8 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e30 ACTIVE INGREDIENTS IN JACQ'S GREEN SMOOTHIE ORGANIC FACE MASQUE \u0026amp; SCRUB\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e \u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"organic leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\" alt=\"oily\/combination skin, globe icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e","published_at":"2017-07-14T12:13:43-04:00","created_at":"2017-06-09T16:31:39-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["charcoal","essential oils","exfoliate","face scrub","green smoothie face mask","lavender","lemon","Moroccan","organic"],"price":1700,"price_min":1700,"price_max":2700,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636537923,"title":"2 oz","option1":"2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":30101985886256,"product_id":10500475139,"position":1,"created_at":"2022-07-07T16:01:43-04:00","updated_at":"2022-07-07T16:01:49-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","variant_ids":[40636537923]},"available":true,"name":"JACQ's Clarifying Green Smoothie Face Masque and Scrub - 2 oz","public_title":"2 oz","options":["2 oz"],"price":2700,"weight":71,"compare_at_price":null,"inventory_quantity":77,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":22439797260336,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":41905034243,"title":"45 ml","option1":"45 ml","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":30101999845424,"product_id":10500475139,"position":5,"created_at":"2022-07-07T16:05:04-04:00","updated_at":"2022-07-07T16:05:04-04:00","alt":null,"width":935,"height":1070,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304","variant_ids":[41905034243]},"available":true,"name":"JACQ's Clarifying Green Smoothie Face Masque and Scrub - 45 ml","public_title":"45 ml","options":["45 ml"],"price":1700,"weight":168,"compare_at_price":null,"inventory_quantity":129,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":22439813480496,"position":5,"preview_image":{"aspect_ratio":0.874,"height":1070,"width":935,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASKFRONT_9a207218-6f87-441f-a19a-3518ae6259bf.jpg?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask_1.png?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_face_mask_caasi1024X1024.jpg?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","options":["Size"],"media":[{"alt":null,"id":22439797260336,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","width":937},{"alt":null,"id":7584607666224,"position":2,"preview_image":{"aspect_ratio":0.874,"height":1067,"width":933,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASKFRONT_9a207218-6f87-441f-a19a-3518ae6259bf.jpg?v=1657224109"},"aspect_ratio":0.874,"height":1067,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASKFRONT_9a207218-6f87-441f-a19a-3518ae6259bf.jpg?v=1657224109","width":933},{"alt":null,"id":7584659111984,"position":3,"preview_image":{"aspect_ratio":0.874,"height":435,"width":380,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask_1.png?v=1657224109"},"aspect_ratio":0.874,"height":435,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask_1.png?v=1657224109","width":380},{"alt":"Black woman wearing JACQ's green smoothie face mask, drinking tea","id":435672875056,"position":4,"preview_image":{"aspect_ratio":1.0,"height":1024,"width":1024,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_face_mask_caasi1024X1024.jpg?v=1657224109"},"aspect_ratio":1.0,"height":1024,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_face_mask_caasi1024X1024.jpg?v=1657224109","width":1024},{"alt":null,"id":22439813480496,"position":5,"preview_image":{"aspect_ratio":0.874,"height":1070,"width":935,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304"},"aspect_ratio":0.874,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304","width":935}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Green Smoothie Organic Face Mask \u0026amp; Scrub with Charcoal and Sea Salt\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eIt's all about the face mask. JACQ's Green Smoothie Face Masque and Scrub aka Clarifying Mask contains an abundance of Minerals, Botanical Peptides and Rich Clays that work to help get oxygen into skin cells. Our blend of Montmorillonite Clay, Activated Charcoal, and Dead Sea Salt paired together with olive-derived Squalane to draw out impurities while nourishing the skin. Protective Vitamin B3, the natural fruit acids extracts, and our proprietary essential oil blend leaves your skin feeling refreshed, cool and clean.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Rhassoul Clay (Moroccan Lava Clay), *Bentonite Clay, *Zea Mays (Corn) Starch, *Bamboo Activated Charcoal Powder, *Tapioca Starch, *Ascophyllum (Kelp Powder) Nodosum Powder, Calophyllum Inophyllum (Tamanu) Oil. Sodium Chloride (Dead Sea Salt), Niacinamide, Spearmint Oil, Lavender Oil, Rosmarinus Officinalis (Rosemary) Oil, Citrus Limonium (Lemon) Oil, Galangal Extract and Pure Essential Oils. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e45ML - Mix 1\/4 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation. 20ML - Mix 1\/8 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e30 ACTIVE INGREDIENTS IN JACQ'S GREEN SMOOTHIE ORGANIC FACE MASQUE \u0026amp; SCRUB\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e \u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"organic leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\" alt=\"oily\/combination skin, globe icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e"}

JACQ's Clarifying Green Smoothie Face Masque and Scrub

$ 17.00
JACQ's Green Smoothie Organic Face Mask & Scrub with Charcoal and Sea Salt PRODUCT INFO INGREDIENTS HOW TO USE It's all about the face mask. JACQ's Green Smoothie Face Masque and Scrub aka Clarifying Mask contains an abundance of Minerals, Botanical Peptides and Rich Clays that work to help get oxygen into skin cells. Our...
JACQ's Beta-Acid Acne Treatment JACQ's Beta-Acid Acne Treatment
{"id":10500476675,"title":"JACQ's Beta-Acid Acne Treatment","handle":"the-high-priestess-beauty-booster","description":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-06-09T16:32:27-04:00","vendor":"JACQ'S","type":"Skin Care","tags":[],"price":1900,"price_min":1900,"price_max":1900,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636551619,"title":"1\/2 oz","option1":"1\/2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793009504304,"product_id":10500476675,"position":3,"created_at":"2021-08-09T15:23:56-04:00","updated_at":"2021-08-09T15:49:07-04:00","alt":null,"width":934,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","variant_ids":[40636551619]},"available":true,"name":"JACQ's Beta-Acid Acne Treatment - 1\/2 oz","public_title":"1\/2 oz","options":["1\/2 oz"],"price":1900,"weight":5,"compare_at_price":null,"inventory_quantity":131,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","options":["Size"],"media":[{"alt":null,"id":21058558591024,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058521497648,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"},"aspect_ratio":0.869,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","width":934},{"alt":null,"id":21058521464880,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e"}

JACQ's Beta-Acid Acne Treatment

$ 19.00
JACQ's Fruit Acid & Probiotics Skin Booster  PRODUCT INFO INGREDIENTS HOW TO USE Meet The High Priestess known for her abundance of Fruit Acid & AHA boosting ingredients. With over 20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple...
JACQ's Detoxifying Face Mask & Scrub Duo 2 jars of JACQ's detoxifying charcoal face mask & scrub
{"id":10620930819,"title":"JACQ's Detoxifying Face Mask \u0026 Scrub Duo","handle":"beat-face-duo","description":"\u003ch2\u003eJACQ'S Organic Moisturizing Face Mask for All Skin Types\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFORMATION\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eSay hello to your new selfie filter! Your selfie is 90% your skin. Achieve happy and clear skin with JACQ's organic face mask duo. Clarifying face mask \u0026amp; scrub to detoxify and unclog pores. Use our NEW Moisturizing face mask on days your skin feels and look a little dull to achieve that dewy glow.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003cimg alt=\"cruetly-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\n\u003c\/div\u003e","published_at":"2020-07-16T14:55:48-04:00","created_at":"2017-07-11T06:01:00-04:00","vendor":"Jacq's Organics ","type":"Face","tags":["charcoal","clarify","detoxify","Face Mask","face scrub","unclog pores"],"price":3000,"price_min":3000,"price_max":3000,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42180532547,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Detoxifying Face Mask \u0026 Scrub Duo","public_title":null,"options":["Default Title"],"price":3000,"weight":99,"compare_at_price":null,"inventory_quantity":203,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsfacemask937x1075.png?v=1657225347","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK2_e938d621-ca96-40f3-be22-ddb4d5695c0d.jpg?v=1657225347","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask.png?v=1657225347"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsfacemask937x1075.png?v=1657225347","options":["Title"],"media":[{"alt":null,"id":22439909064752,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsfacemask937x1075.png?v=1657225347"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsfacemask937x1075.png?v=1657225347","width":937},{"alt":"2 jars of JACQ's detoxifying charcoal face mask \u0026 scrub","id":7587724853296,"position":2,"preview_image":{"aspect_ratio":0.874,"height":1067,"width":933,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK2_e938d621-ca96-40f3-be22-ddb4d5695c0d.jpg?v=1657225347"},"aspect_ratio":0.874,"height":1067,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK2_e938d621-ca96-40f3-be22-ddb4d5695c0d.jpg?v=1657225347","width":933},{"alt":"Black woman using JACQ's detoxifying charcoal face mask ","id":7584690864176,"position":3,"preview_image":{"aspect_ratio":0.874,"height":435,"width":380,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask.png?v=1657225347"},"aspect_ratio":0.874,"height":435,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask.png?v=1657225347","width":380}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ'S Organic Moisturizing Face Mask for All Skin Types\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFORMATION\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eSay hello to your new selfie filter! Your selfie is 90% your skin. Achieve happy and clear skin with JACQ's organic face mask duo. Clarifying face mask \u0026amp; scrub to detoxify and unclog pores. Use our NEW Moisturizing face mask on days your skin feels and look a little dull to achieve that dewy glow.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003cimg alt=\"cruetly-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\n\u003c\/div\u003e"}

JACQ's Detoxifying Face Mask & Scrub Duo

$ 30.00
JACQ'S Organic Moisturizing Face Mask for All Skin Types PRODUCT INFORMATION Say hello to your new selfie filter! Your selfie is 90% your skin. Achieve happy and clear skin with JACQ's organic face mask duo. Clarifying face mask & scrub to detoxify and unclog pores. Use our NEW Moisturizing face mask on days your skin...
{"id":10500480579,"title":"JACQ's PROBIOTIC FACE MASK","handle":"probiotic-face-mask-1","description":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:34-04:00","created_at":"2017-06-09T16:34:13-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","antioxidant","booster","Carrot","emollient","essential oils","Face Mask","face oil","face serum","jackfruit","moisturizer","papaya","protein","skin serum","vitamin E","yucca"],"price":2300,"price_min":2300,"price_max":2300,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636604483,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":29235789692976,"product_id":10500480579,"position":2,"created_at":"2021-12-15T14:18:06-05:00","updated_at":"2022-07-07T16:10:34-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","variant_ids":[40636604483]},"available":true,"name":"JACQ's PROBIOTIC FACE MASK - 2oz","public_title":"2oz","options":["2oz"],"price":2300,"weight":85,"compare_at_price":null,"inventory_quantity":143,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21516283084848,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","options":["Size"],"media":[{"alt":null,"id":22439844610096,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","width":937},{"alt":null,"id":21516283084848,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","width":937},{"alt":null,"id":21058609020976,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634","width":937},{"alt":null,"id":21058585428016,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634","width":937},{"alt":null,"id":21058608988208,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634","width":937},{"alt":null,"id":22439843332144,"position":6,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e"}


$ 23.00
JACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin PRODUCT INFO INGREDIENTS HOW TO USE Have faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. The natural Phytochemicals, Tri-Enzymes and Proteins beautifully works to quench and...
JACQ's Restorative Face Serum JACQ's Restorative Face Serum
{"id":10636301379,"title":"JACQ's Restorative Face Serum","handle":"jacqs-restorative-face-serum","description":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-07-14T13:01:45-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["amino acids","booster","chamomile","hibiscus","Moringa","plant nutrients","Vitamin A","Vitamin D"],"price":2400,"price_min":2400,"price_max":2400,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42338644867,"title":"1oz","option1":"1oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793074614320,"product_id":10636301379,"position":1,"created_at":"2021-08-09T16:11:09-04:00","updated_at":"2021-08-09T17:44:38-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","variant_ids":[42338644867]},"available":true,"name":"JACQ's Restorative Face Serum - 1oz","public_title":"1oz","options":["1oz"],"price":2400,"weight":5,"compare_at_price":null,"inventory_quantity":37,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","options":["Size"],"media":[{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","width":937},{"alt":null,"id":21058578481200,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","width":937},{"alt":null,"id":21058578513968,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","width":937},{"alt":null,"id":21058578546736,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e"}

JACQ's Restorative Face Serum

$ 24.00
JACQ's Fragrance-Free Vitamin-Packed Skin Booster  PRODUCT INFO INGREDIENTS HOW TO USE Meet The Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little TLC. This illuminating and healing concentrated booster is fragrance-free and contains a powerful and potent super blend of Moringa, Alfalfa, sweet Yarrow and...
JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit
{"id":432966860829,"title":"JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit","handle":"heal-slay-kit-save-10","description":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Best-Selling Heal \u0026amp; Slay Vegan Skincare Trio: Face Cleanser, Toner, and Moisturizer\u003c\/span\u003e\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFORMATION\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHere's the perfect Heal and Slay Vegan Skincare Kit. This cruelty-free beauty kit contains our best sellers. Enjoy this magical trio including the JACQ's Healing Face Cleanser, Revitalizing Face Toner and Nourishing Face Moisturizer all work together to help you slay the day, that meeting, those exams or just to slay selfies. Slaying just got a lot easier!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e","published_at":"2017-07-11T19:04:06-04:00","created_at":"2018-03-08T15:45:59-05:00","vendor":"Jacq's Organics","type":"Gifts","tags":["bundle","coconut","CoQ10","face cleanser","face moisturizer","face toner","heal \u0026 slay kit","moringa","trio","yucca"],"price":7100,"price_min":7100,"price_max":7100,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":32324153049136,"title":"Full size","option1":"Full size","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit - Full size","public_title":"Full size","options":["Full size"],"price":7100,"weight":371,"compare_at_price":null,"inventory_quantity":135,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealandkitboxes.jpg?v=1649449002","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit.png?v=1649449002"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002","options":["Size:"],"media":[{"alt":null,"id":22002511708208,"position":1,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002","width":2048},{"alt":null,"id":21058647392304,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealandkitboxes.jpg?v=1649449002"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealandkitboxes.jpg?v=1649449002","width":937},{"alt":null,"id":21179951677488,"position":3,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit.png?v=1649449002"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit.png?v=1649449002","width":2048}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Best-Selling Heal \u0026amp; Slay Vegan Skincare Trio: Face Cleanser, Toner, and Moisturizer\u003c\/span\u003e\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFORMATION\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHere's the perfect Heal and Slay Vegan Skincare Kit. This cruelty-free beauty kit contains our best sellers. Enjoy this magical trio including the JACQ's Healing Face Cleanser, Revitalizing Face Toner and Nourishing Face Moisturizer all work together to help you slay the day, that meeting, those exams or just to slay selfies. Slaying just got a lot easier!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e"}

JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit

$ 71.00
JACQ's Best-Selling Heal & Slay Vegan Skincare Trio: Face Cleanser, Toner, and Moisturizer PRODUCT INFORMATION Here's the perfect Heal and Slay Vegan Skincare Kit. This cruelty-free beauty kit contains our best sellers. Enjoy this magical trio including the JACQ's Healing Face Cleanser, Revitalizing Face Toner and Nourishing Face Moisturizer all...
JACQ's pink beauty & bath bar packaging x 3 Black woman holding 2 JACQ's beauty bars, charcoal, and beige
{"id":440322588701,"title":"JACQ's Exfoliating Beauty Bar Trio","handle":"beauty-bar-trio","description":"\u003ch2\u003eCleanse, Exfoliate, and Detoxify with JACQ'S Beauty Bar Set\u003c\/h2\u003e\n\u003cp\u003eWho said the only way to detox is by drinking a smoothie, detoxing, or sipping on tea? Here's the perfect way to cleanse, exfoliate, and detox your skin from the outside in. With JACQ's Beauty Bar Set, each bar formulated to help remove dirt, grime, and oils from your skin. The collections come with:\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e\u003cspan\u003e1- 2oz Plantain \u0026amp; Charcoal Beauty Bar\u003c\/span\u003e\u003c\/li\u003e\n\u003cli\u003e\u003cspan\u003e\u003cspan\u003e1- 2oz Hibiscus \u0026amp; Wild Carrot Beauty Bar\u003c\/span\u003e\u003c\/span\u003e\u003c\/li\u003e\n\u003cli\u003e\u003cspan\u003e\u003cspan\u003e1- 2oz Lavender \u0026amp; Yucca Beauty Bar\u003c\/span\u003e\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan\u003e\u003cspan\u003e*Pick any variation of the soap bars. Leave a comment at checkout explaining which bars you'd like to include in your order.\u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eHow to Use JACQ's Beauty Bars:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eSee individual product pages for instructions.\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_31a31d7b-01a1-4771-944c-1f6f542a5ac3_compact.jpg?v=1519958948\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"organic ingredients, plant icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\n\u003c\/div\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eShips in 1-2 business days.\u003c\/p\u003e","published_at":"2018-03-13T11:07:54-04:00","created_at":"2018-03-13T10:52:38-04:00","vendor":"Jacq's","type":"Gifts","tags":["beauty bar","bundle","carrot","charcoal","gift set","hibiscus","lavender","plantain","yucca"],"price":1750,"price_min":1750,"price_max":3800,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":5927684997149,"title":"4oz Beauty Bars","option1":"4oz Beauty Bars","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15388810281008,"product_id":440322588701,"position":1,"created_at":"2020-07-16T08:20:06-04:00","updated_at":"2021-09-23T12:53:34-04:00","alt":"JACQ's pink beauty \u0026 bath bar packaging x 3","width":934,"height":1002,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014","variant_ids":[5927684997149]},"available":true,"name":"JACQ's Exfoliating Beauty Bar Trio - 4oz Beauty Bars","public_title":"4oz Beauty Bars","options":["4oz Beauty Bars"],"price":3800,"weight":170,"compare_at_price":null,"inventory_quantity":195,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":"JACQ's pink beauty \u0026 bath bar packaging x 3","id":7562204774448,"position":1,"preview_image":{"aspect_ratio":0.932,"height":1002,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":32324163436592,"title":"2oz Beauty Bars","option1":"2oz Beauty Bars","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":1836903301149,"product_id":440322588701,"position":4,"created_at":"2018-03-20T15:41:27-04:00","updated_at":"2021-09-23T12:53:34-04:00","alt":"stack of JACQ's organic beauty bars","width":1280,"height":1920,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_charcoal_soap3.jpg?v=1632416014","variant_ids":[32324163436592]},"available":true,"name":"JACQ's Exfoliating Beauty Bar Trio - 2oz Beauty Bars","public_title":"2oz Beauty Bars","options":["2oz Beauty Bars"],"price":1750,"weight":170,"compare_at_price":null,"inventory_quantity":260,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":"stack of JACQ's organic beauty bars","id":813445283888,"position":4,"preview_image":{"aspect_ratio":0.667,"height":1920,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_charcoal_soap3.jpg?v=1632416014"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_organics_soap_bundle_2018.jpg?v=1632416014","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit1.png?v=1632416003","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_charcoal_soap3.jpg?v=1632416014"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014","options":["Beauty Bars Trio"],"media":[{"alt":"JACQ's pink beauty \u0026 bath bar packaging x 3","id":7562204774448,"position":1,"preview_image":{"aspect_ratio":0.932,"height":1002,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014"},"aspect_ratio":0.932,"height":1002,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014","width":934},{"alt":"Black woman holding 2 JACQ's beauty bars, charcoal, and beige","id":1015855448112,"position":2,"preview_image":{"aspect_ratio":0.768,"height":1666,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_organics_soap_bundle_2018.jpg?v=1632416014"},"aspect_ratio":0.768,"height":1666,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_organics_soap_bundle_2018.jpg?v=1632416014","width":1280},{"alt":null,"id":21180004237360,"position":3,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit1.png?v=1632416003"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit1.png?v=1632416003","width":2048},{"alt":"stack of JACQ's organic beauty bars","id":813445283888,"position":4,"preview_image":{"aspect_ratio":0.667,"height":1920,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_charcoal_soap3.jpg?v=1632416014"},"aspect_ratio":0.667,"height":1920,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_charcoal_soap3.jpg?v=1632416014","width":1280}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eCleanse, Exfoliate, and Detoxify with JACQ'S Beauty Bar Set\u003c\/h2\u003e\n\u003cp\u003eWho said the only way to detox is by drinking a smoothie, detoxing, or sipping on tea? Here's the perfect way to cleanse, exfoliate, and detox your skin from the outside in. With JACQ's Beauty Bar Set, each bar formulated to help remove dirt, grime, and oils from your skin. The collections come with:\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e\u003cspan\u003e1- 2oz Plantain \u0026amp; Charcoal Beauty Bar\u003c\/span\u003e\u003c\/li\u003e\n\u003cli\u003e\u003cspan\u003e\u003cspan\u003e1- 2oz Hibiscus \u0026amp; Wild Carrot Beauty Bar\u003c\/span\u003e\u003c\/span\u003e\u003c\/li\u003e\n\u003cli\u003e\u003cspan\u003e\u003cspan\u003e1- 2oz Lavender \u0026amp; Yucca Beauty Bar\u003c\/span\u003e\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan\u003e\u003cspan\u003e*Pick any variation of the soap bars. Leave a comment at checkout explaining which bars you'd like to include in your order.\u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eHow to Use JACQ's Beauty Bars:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eSee individual product pages for instructions.\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_31a31d7b-01a1-4771-944c-1f6f542a5ac3_compact.jpg?v=1519958948\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"organic ingredients, plant icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\n\u003c\/div\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eShips in 1-2 business days.\u003c\/p\u003e"}

JACQ's Exfoliating Beauty Bar Trio

$ 17.50
Cleanse, Exfoliate, and Detoxify with JACQ'S Beauty Bar Set Who said the only way to detox is by drinking a smoothie, detoxing, or sipping on tea? Here's the perfect way to cleanse, exfoliate, and detox your skin from the outside in. With JACQ's Beauty Bar Set, each bar formulated to help remove...
JACQ's Clear Essentials Skincare Kit
{"id":2155883003952,"title":"JACQ's Clear Essentials Skincare Kit","handle":"jacqs-skincare-holiday-gift-set","description":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Skincare Gift Set\u003c\/span\u003e\u003c\/h2\u003e\n\u003cbr\u003eGet healthy, radiant skin with this on the go glow essentials kit. Gently cleanse away dirt without stripping your skin of essential nutrients and moisture with our Healing Face Cleanser followed by our delicious Revitalizing Face Toner and tone your skin. Then hydrate and restore with our Balancing Face Serum packed with omega fatty acids to remedy breakouts and premature aging. Treat yourself to this magical trio. Slaying just got a lot easier!\u003cbr\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"Organic ingredients, leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\" alt=\"cruelty-free, cat icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e","published_at":"2017-07-11T19:04:06-04:00","created_at":"2018-11-23T09:39:24-05:00","vendor":"Jacq's Organics","type":"Gifts","tags":["cleanser","face cleanser","face serum","face toner","gift set","holiday gift set"],"price":7500,"price_min":7500,"price_max":7500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":21665727643696,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Clear Essentials Skincare Kit","public_title":null,"options":["Default Title"],"price":7500,"weight":283,"compare_at_price":null,"inventory_quantity":222,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197","options":["Title"],"media":[{"alt":null,"id":7584341229616,"position":1,"preview_image":{"aspect_ratio":0.87,"height":1071,"width":932,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197"},"aspect_ratio":0.87,"height":1071,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197","width":932}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Skincare Gift Set\u003c\/span\u003e\u003c\/h2\u003e\n\u003cbr\u003eGet healthy, radiant skin with this on the go glow essentials kit. Gently cleanse away dirt without stripping your skin of essential nutrients and moisture with our Healing Face Cleanser followed by our delicious Revitalizing Face Toner and tone your skin. Then hydrate and restore with our Balancing Face Serum packed with omega fatty acids to remedy breakouts and premature aging. Treat yourself to this magical trio. Slaying just got a lot easier!\u003cbr\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"Organic ingredients, leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\" alt=\"cruelty-free, cat icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e"}

JACQ's Clear Essentials Skincare Kit

$ 75.00
JACQ's Skincare Gift Set Get healthy, radiant skin with this on the go glow essentials kit. Gently cleanse away dirt without stripping your skin of essential nutrients and moisture with our Healing Face Cleanser followed by our delicious Revitalizing Face Toner and tone your skin. Then hydrate and restore with our Balancing...
Showing items 1 - 12 of 16
We use cookies to improve our website and your shopping experience.By continuing to browse our site, you are consenting to our use of cookies. Read more about our Privacy Policy