SHOP CLEAN + conscious beauty products

JACQ'S Revitalizing Face Toner JACQ'S Revitalizing Face Toner
{"id":10471658243,"title":"JACQ'S Revitalizing Face Toner","handle":"revitalizing-face-toner","description":"\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eA\u003cstrong\u003e hydrating floral tea for your skin\u003c\/strong\u003e formulated with refreshing Mint, toning and moisturizing \u003cstrong\u003eHibiscus pedals and healing Burdock Root\u003c\/strong\u003e. A perfect blend of herbal extracts,\u003cstrong\u003e fatty acids, and vitamins\u003c\/strong\u003e, this toner was crafted to\u003cstrong\u003e restores skin pH balance. minimize the appearance of pores, tone and remove excess residue from makeup, dirt, and oils\u003c\/strong\u003e.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003eWater (Aqua), *Hibiscus Rosa Sinensis Linn (Hibiscus), *Mentha Citrus Sinensis (Orange Mint), Rosa Centifolia (Rose), *Prunus Amygdalus Dulcis (Sweet Almond) Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Arctium Lappa (Burdock) Extract, *Echinacea Purpurea Extract, *Rumex (Yellow Dock) Crispus Extract, *Chamomilla Recutita (Matricaria) Extract, *Rosa Moschata (Rosehip) Seed Oil, Hippophae Rhamnoides (Sea Buckthorn) Seed Oil, *Aloe Barbadensis Extract, Ubiquinone (CoQ10), Leucidal Liquid (Radish Root Ferment) and Pure Essential Oils . *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eAfter cleansing, moisten a cotton pad with the toner and gently wipe across the forehead, cheek, and throat in an upward with outward motions. Avoid eye area.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"color: #0b5394;\"\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003eBurdock Root \u003c\/b\u003econtains ingredients known for cleansing the lymphatic system. It's antifungal and antibacterial and an ideal ingredient for regulating oil production in the skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eCoQ10 \u003c\/b\u003eacts as an antioxidant, energizes your skin and helps improves skin elasticity.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eHibiscus\u003c\/strong\u003e is a natural astringent rich in calcium, magnesium, and iron. A cooling and refreshing source of vegetable acids and vitamins A, B6, B12,, 12 C \u0026amp; D. Great for acne and oily combination skin.\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:33-04:00","created_at":"2017-06-01T21:34:06-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["probiotics"],"price":2499,"price_min":2499,"price_max":2499,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40244950211,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15388612362288,"product_id":10471658243,"position":1,"created_at":"2020-07-16T07:34:52-04:00","updated_at":"2020-07-16T07:34:54-04:00","alt":null,"width":934,"height":1064,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","variant_ids":[40244950211]},"available":true,"name":"JACQ'S Revitalizing Face Toner - 2oz","public_title":"2oz","options":["2oz"],"price":2499,"weight":85,"compare_at_price":null,"inventory_quantity":78,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":7562006659120,"position":1,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsfacetoner937x1075.png?v=1657226523","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerfront.jpg?v=1657226523"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","options":["Size"],"media":[{"alt":null,"id":7562006659120,"position":1,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294"},"aspect_ratio":0.878,"height":1064,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","width":934},{"alt":null,"id":22440012349488,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsfacetoner937x1075.png?v=1657226523"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsfacetoner937x1075.png?v=1657226523","width":937},{"alt":null,"id":7562005446704,"position":3,"preview_image":{"aspect_ratio":0.871,"height":1070,"width":932,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerfront.jpg?v=1657226523"},"aspect_ratio":0.871,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerfront.jpg?v=1657226523","width":932}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eA\u003cstrong\u003e hydrating floral tea for your skin\u003c\/strong\u003e formulated with refreshing Mint, toning and moisturizing \u003cstrong\u003eHibiscus pedals and healing Burdock Root\u003c\/strong\u003e. A perfect blend of herbal extracts,\u003cstrong\u003e fatty acids, and vitamins\u003c\/strong\u003e, this toner was crafted to\u003cstrong\u003e restores skin pH balance. minimize the appearance of pores, tone and remove excess residue from makeup, dirt, and oils\u003c\/strong\u003e.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003eWater (Aqua), *Hibiscus Rosa Sinensis Linn (Hibiscus), *Mentha Citrus Sinensis (Orange Mint), Rosa Centifolia (Rose), *Prunus Amygdalus Dulcis (Sweet Almond) Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Arctium Lappa (Burdock) Extract, *Echinacea Purpurea Extract, *Rumex (Yellow Dock) Crispus Extract, *Chamomilla Recutita (Matricaria) Extract, *Rosa Moschata (Rosehip) Seed Oil, Hippophae Rhamnoides (Sea Buckthorn) Seed Oil, *Aloe Barbadensis Extract, Ubiquinone (CoQ10), Leucidal Liquid (Radish Root Ferment) and Pure Essential Oils . *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eAfter cleansing, moisten a cotton pad with the toner and gently wipe across the forehead, cheek, and throat in an upward with outward motions. Avoid eye area.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"color: #0b5394;\"\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003eBurdock Root \u003c\/b\u003econtains ingredients known for cleansing the lymphatic system. It's antifungal and antibacterial and an ideal ingredient for regulating oil production in the skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eCoQ10 \u003c\/b\u003eacts as an antioxidant, energizes your skin and helps improves skin elasticity.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eHibiscus\u003c\/strong\u003e is a natural astringent rich in calcium, magnesium, and iron. A cooling and refreshing source of vegetable acids and vitamins A, B6, B12,, 12 C \u0026amp; D. Great for acne and oily combination skin.\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ'S Balancing Face Serum JACQ's calm & repair face serum
{"id":10500458115,"title":"JACQ'S Balancing Face Serum","handle":"balancing-face-serum","description":"\u003ch2\u003eVegan-Friendly Face Serum with vitamin boost\u003c\/h2\u003e\n\u003cp\u003e10 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThe root of a \u003cstrong\u003ecarrot contains 89% water.\u003c\/strong\u003e This magical plant is high in \u003cstrong\u003eBeta-carotene, Minerals and Vitamins A, B, C and E\u003c\/strong\u003e. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result is hydrating and supple skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Carthamus (Safflower) Tinctorius, *Rosa Canina (Rosehip) Seed Fruit Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Falcatum (Bupleurum) Root Extract, *Rumex (Yellow Dock) Crispus Extract, *Gentiana Lutea (Gentian) Root Extract, *Aloe Barbadensis Extract, Glycerin, Hippophae Rhamnoides (Sea Buckthorn Berry) CO2 extract, *Pelargonium (Rose Geranium) Graveolens Oil, *Ocimum Basillicum (Basil) Oil, Panthenol, Pure Essential Oils, Tocopherol (non-GM0) and Ferulic Acid. **Certified Organic Ingredient\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eA little goes a long way. Warm one to two drops between hands then gently press onto damp face, neck and decolletage.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e 20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e\n\u003ch3\u003e\n\u003cstrong\u003eKEY \u003c\/strong\u003e\u003cstrong\u003eINGREDIENTS\u003c\/strong\u003e FOR JACQ'S ORGANIC FACE SERUM\u003c\/h3\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003eCarrot\u003c\/strong\u003e is a natural source of beta-carotene, biotin and lycopene. Great for feeding skin antioxidants, cellular reproduction and improving skin texture.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Geranium\u003c\/strong\u003e is an aromatic, floral and sweet essential oil that's an ideal ingredient that \u003cspan\u003epromotes \u003c\/span\u003e\u003cem\u003eskin\u003c\/em\u003e\u003cspan\u003e cell renewal and ideal ingredient for all skin for every skin type.\u003c\/span\u003e \u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eFerulic Acid\u003c\/strong\u003e is a plant-based antioxidant with a rich source of Vitamin C \u0026amp; E. A beautiful ingredient known to naturally brighten skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRosehip Seed Oil\u003c\/strong\u003e is packed with vitamins, antioxidants and essential fatty acids that help combat uneven skin tone and fine lines. \u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-14T12:13:43-04:00","created_at":"2017-06-09T16:24:14-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["antiaging","beta carotene","carrot","face serum","ferulic acid","minerals","rosehip seed oil","vitamin A","Vitamin B","Vitamin C"],"price":1900,"price_min":1900,"price_max":6200,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636383363,"title":"1oz","option1":"1oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S Balancing Face Serum - 1oz","public_title":"1oz","options":["1oz"],"price":6200,"weight":85,"compare_at_price":null,"inventory_quantity":147,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]},{"id":31932473475120,"title":"5g","option1":"5g","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S Balancing Face Serum - 5g","public_title":"5g","options":["5g"],"price":1900,"weight":10,"compare_at_price":null,"inventory_quantity":276,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum2937x1075.png?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumback.jpg?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs7gbalancingfaceserumfront.jpg?v=1657228018"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018","options":["Size"],"media":[{"alt":null,"id":22440135163952,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018","width":937},{"alt":"JACQ's calm \u0026 repair face serum","id":7561919660080,"position":2,"preview_image":{"aspect_ratio":0.881,"height":1063,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1657228018"},"aspect_ratio":0.881,"height":1063,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1657228018","width":937},{"alt":null,"id":22440140668976,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum2937x1075.png?v=1657228018"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum2937x1075.png?v=1657228018","width":937},{"alt":"JACQ's calm \u0026 repair face serum ingredients label","id":7561919627312,"position":4,"preview_image":{"aspect_ratio":0.873,"height":1070,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumback.jpg?v=1657228018"},"aspect_ratio":0.873,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumback.jpg?v=1657228018","width":934},{"alt":"JACQ's Balancing Face Serum ","id":7561935388720,"position":5,"preview_image":{"aspect_ratio":0.869,"height":1073,"width":932,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs7gbalancingfaceserumfront.jpg?v=1657228018"},"aspect_ratio":0.869,"height":1073,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs7gbalancingfaceserumfront.jpg?v=1657228018","width":932}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eVegan-Friendly Face Serum with vitamin boost\u003c\/h2\u003e\n\u003cp\u003e10 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThe root of a \u003cstrong\u003ecarrot contains 89% water.\u003c\/strong\u003e This magical plant is high in \u003cstrong\u003eBeta-carotene, Minerals and Vitamins A, B, C and E\u003c\/strong\u003e. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result is hydrating and supple skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Carthamus (Safflower) Tinctorius, *Rosa Canina (Rosehip) Seed Fruit Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Falcatum (Bupleurum) Root Extract, *Rumex (Yellow Dock) Crispus Extract, *Gentiana Lutea (Gentian) Root Extract, *Aloe Barbadensis Extract, Glycerin, Hippophae Rhamnoides (Sea Buckthorn Berry) CO2 extract, *Pelargonium (Rose Geranium) Graveolens Oil, *Ocimum Basillicum (Basil) Oil, Panthenol, Pure Essential Oils, Tocopherol (non-GM0) and Ferulic Acid. **Certified Organic Ingredient\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eA little goes a long way. Warm one to two drops between hands then gently press onto damp face, neck and decolletage.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e 20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e\n\u003ch3\u003e\n\u003cstrong\u003eKEY \u003c\/strong\u003e\u003cstrong\u003eINGREDIENTS\u003c\/strong\u003e FOR JACQ'S ORGANIC FACE SERUM\u003c\/h3\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003eCarrot\u003c\/strong\u003e is a natural source of beta-carotene, biotin and lycopene. Great for feeding skin antioxidants, cellular reproduction and improving skin texture.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Geranium\u003c\/strong\u003e is an aromatic, floral and sweet essential oil that's an ideal ingredient that \u003cspan\u003epromotes \u003c\/span\u003e\u003cem\u003eskin\u003c\/em\u003e\u003cspan\u003e cell renewal and ideal ingredient for all skin for every skin type.\u003c\/span\u003e \u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eFerulic Acid\u003c\/strong\u003e is a plant-based antioxidant with a rich source of Vitamin C \u0026amp; E. A beautiful ingredient known to naturally brighten skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRosehip Seed Oil\u003c\/strong\u003e is packed with vitamins, antioxidants and essential fatty acids that help combat uneven skin tone and fine lines. \u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e"}
JACQ'S BEAUTY & BATH BAR FOR CLEANSING & EXFOLIATING Black woman holding JACQ's activated charcoal face cleansing bar
{"id":280219680797,"title":"JACQ's Plantain \u0026 Activated Charcoal Face Cleansing Bar","handle":"jacqs-plantain-charcoal-face-cleansing-bar","description":"\u003ch2\u003eUnclog Pores with JACQ's Plantain \u0026amp; Charcoal Face Cleansing Bar for Oily \u0026amp; Acne-Prone Skin\u003c\/h2\u003e\n\u003ch3\u003eWHAT IS IT?\u003c\/h3\u003e\n\u003cdiv\u003e\n\u003cspan\u003ePlantain peel and activated bamboo charcoal are the two main ingredients in this intoxicating cleansing bar to gently scrub away the day. Use it on your face or body, this bar is ideal for clogged pores, oily skin and acne-prone skin. The bamboo charcoal works to absorb oils and toxins from the body. T\u003c\/span\u003ehe combination\u003cspan\u003e of plantain, oils and activated charcoal delivers nutrients, \u003c\/span\u003eminerals\u003cspan\u003e and vitamins that work together to heal and protect skin. \u003c\/span\u003eGot annoying blemishes on your face, back and arms? Then we've got you covered. Give our cleansing bar a try. AVAILABLE IN A SMALLER SIZE. \u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003ch3\u003e\u003cstrong\u003eJACQ'S VEGAN-FRIENDLY PLANTAIN \u0026amp; CHARCOAL FACE CLEANSING BAR DETAILS:\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"ALL SKIN TYPES ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cimg alt=\"VEGAN-FRIENDLY BIRD ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_small.jpg?v=1499303284\" style=\"float: none;\"\u003e\u003cimg alt=\"CRUELTY-FREE BUNNY ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_small.jpg?v=1499297299\" style=\"float: none;\"\u003e  \u003cimg alt=\"ORGANIC INGREDIENTS LEAF ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003cimg alt=\"UNICORN ICON, HANDMADE IN SMALL BATCHES\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003ch3 style=\"text-align: left;\"\u003e\u003cstrong\u003eWHAT'S IN JACQ'S PLANTAIN \u0026amp; ACTIVATED CHARCOAL CLEANSING BAR:\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cdiv style=\"text-align: left;\"\u003eSaponified oils of Cocos Nucifera (Coconut) Oil, Helianthus Annuus (Sunflower) Seed Oil, Theobroma Cacao (Cocoa) Seed Butter, Aloe Barbadensis Leaf Juice, Plantago (Plantain) Peel Powder *Palma Christi (Haitian Castor Oil), *Activated Bamboo Charcoal, *Citrus Medica Limonum (Lemon) Oil, Pinus (Pine Needle) Sylvestris leaf Oil and Pure Essential Oils. *Certified Organic\u003cbr\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cstrong\u003e\u003cspan\u003ePrecaution: \u003c\/span\u003e\u003c\/strong\u003e\u003cspan\u003eFOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cul class=\"tabs-content\"\u003e\u003c\/ul\u003e","published_at":"2017-11-10T07:07:27-05:00","created_at":"2017-11-10T07:24:18-05:00","vendor":"jacqsorganics","type":"Soap","tags":["black soap","charcoal","fancy detox","plantain","soap"],"price":750,"price_min":750,"price_max":1400,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4029986766877,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":1748337131549,"product_id":280219680797,"position":4,"created_at":"2018-02-22T10:28:06-05:00","updated_at":"2020-07-21T09:55:12-04:00","alt":"JACQ's Skincare - organic face cleansing bars x 4","width":1280,"height":1920,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/pumpkin_and_charcoal_cleansing_soap_jacqs.jpg?v=1595339712","variant_ids":[4029986766877]},"available":true,"name":"JACQ's Plantain \u0026 Activated Charcoal Face Cleansing Bar - 2oz","public_title":"2oz","options":["2oz"],"price":750,"weight":85,"compare_at_price":null,"inventory_quantity":153,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":"JACQ's Skincare - organic face cleansing bars x 4","id":812127715376,"position":4,"preview_image":{"aspect_ratio":0.667,"height":1920,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/pumpkin_and_charcoal_cleansing_soap_jacqs.jpg?v=1595339712"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":4029986799645,"title":"4oz","option1":"4oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Plantain \u0026 Activated Charcoal Face Cleansing Bar - 4oz","public_title":"4oz","options":["4oz"],"price":1400,"weight":85,"compare_at_price":null,"inventory_quantity":99,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoap.jpg?v=1596329025","\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_soap_bar_jacqs.jpg?v=1595339712","\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqs_PlantainCharcoal_Soap_Render3.jpg?v=1596329052","\/\/\/s\/files\/1\/0877\/4074\/products\/pumpkin_and_charcoal_cleansing_soap_jacqs.jpg?v=1595339712","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoapback.jpg?v=1596329041"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoap.jpg?v=1596329025","options":["Size"],"media":[{"alt":"JACQ'S BEAUTY \u0026 BATH BAR FOR CLEANSING \u0026 EXFOLIATING","id":7584497696816,"position":1,"preview_image":{"aspect_ratio":0.875,"height":1068,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoap.jpg?v=1596329025"},"aspect_ratio":0.875,"height":1068,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoap.jpg?v=1596329025","width":934},{"alt":"Black woman holding JACQ's activated charcoal face cleansing bar","id":812127977520,"position":2,"preview_image":{"aspect_ratio":0.825,"height":1552,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_soap_bar_jacqs.jpg?v=1595339712"},"aspect_ratio":0.825,"height":1552,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_soap_bar_jacqs.jpg?v=1595339712","width":1280},{"alt":"JACQ'S BEAUTY BAR PACKAGING, FRONT","id":7584433700912,"position":3,"preview_image":{"aspect_ratio":1.408,"height":2300,"width":3238,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqs_PlantainCharcoal_Soap_Render3.jpg?v=1596329052"},"aspect_ratio":1.408,"height":2300,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqs_PlantainCharcoal_Soap_Render3.jpg?v=1596329052","width":3238},{"alt":"JACQ's Skincare - organic face cleansing bars x 4","id":812127715376,"position":4,"preview_image":{"aspect_ratio":0.667,"height":1920,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/pumpkin_and_charcoal_cleansing_soap_jacqs.jpg?v=1595339712"},"aspect_ratio":0.667,"height":1920,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/pumpkin_and_charcoal_cleansing_soap_jacqs.jpg?v=1595339712","width":1280},{"alt":"JACQ'S BEAUTY BAR PACKAGING, PINK","id":7562146873392,"position":5,"preview_image":{"aspect_ratio":0.871,"height":1072,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoapback.jpg?v=1596329041"},"aspect_ratio":0.871,"height":1072,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoapback.jpg?v=1596329041","width":934}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eUnclog Pores with JACQ's Plantain \u0026amp; Charcoal Face Cleansing Bar for Oily \u0026amp; Acne-Prone Skin\u003c\/h2\u003e\n\u003ch3\u003eWHAT IS IT?\u003c\/h3\u003e\n\u003cdiv\u003e\n\u003cspan\u003ePlantain peel and activated bamboo charcoal are the two main ingredients in this intoxicating cleansing bar to gently scrub away the day. Use it on your face or body, this bar is ideal for clogged pores, oily skin and acne-prone skin. The bamboo charcoal works to absorb oils and toxins from the body. T\u003c\/span\u003ehe combination\u003cspan\u003e of plantain, oils and activated charcoal delivers nutrients, \u003c\/span\u003eminerals\u003cspan\u003e and vitamins that work together to heal and protect skin. \u003c\/span\u003eGot annoying blemishes on your face, back and arms? Then we've got you covered. Give our cleansing bar a try. AVAILABLE IN A SMALLER SIZE. \u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003ch3\u003e\u003cstrong\u003eJACQ'S VEGAN-FRIENDLY PLANTAIN \u0026amp; CHARCOAL FACE CLEANSING BAR DETAILS:\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"ALL SKIN TYPES ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cimg alt=\"VEGAN-FRIENDLY BIRD ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_small.jpg?v=1499303284\" style=\"float: none;\"\u003e\u003cimg alt=\"CRUELTY-FREE BUNNY ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_small.jpg?v=1499297299\" style=\"float: none;\"\u003e  \u003cimg alt=\"ORGANIC INGREDIENTS LEAF ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003cimg alt=\"UNICORN ICON, HANDMADE IN SMALL BATCHES\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003ch3 style=\"text-align: left;\"\u003e\u003cstrong\u003eWHAT'S IN JACQ'S PLANTAIN \u0026amp; ACTIVATED CHARCOAL CLEANSING BAR:\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cdiv style=\"text-align: left;\"\u003eSaponified oils of Cocos Nucifera (Coconut) Oil, Helianthus Annuus (Sunflower) Seed Oil, Theobroma Cacao (Cocoa) Seed Butter, Aloe Barbadensis Leaf Juice, Plantago (Plantain) Peel Powder *Palma Christi (Haitian Castor Oil), *Activated Bamboo Charcoal, *Citrus Medica Limonum (Lemon) Oil, Pinus (Pine Needle) Sylvestris leaf Oil and Pure Essential Oils. *Certified Organic\u003cbr\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cstrong\u003e\u003cspan\u003ePrecaution: \u003c\/span\u003e\u003c\/strong\u003e\u003cspan\u003eFOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cul class=\"tabs-content\"\u003e\u003c\/ul\u003e"}
JACQ's Clarifying Green Smoothie Face Masque and Scrub JACQ's Clarifying Green Smoothie Face Masque and Scrub
{"id":10500475139,"title":"JACQ's Clarifying Green Smoothie Face Masque and Scrub","handle":"jacqs-clarifying-green-smoothie-face-mask-scrub","description":"\u003ch2\u003eJACQ's Green Smoothie Organic Face Mask \u0026amp; Scrub with Charcoal and Sea Salt\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eIt's all about the face mask. JACQ's Green Smoothie Face Masque and Scrub aka Clarifying Mask contains an abundance of Minerals, Botanical Peptides and Rich Clays that work to help get oxygen into skin cells. Our blend of Montmorillonite Clay, Activated Charcoal, and Dead Sea Salt paired together with olive-derived Squalane to draw out impurities while nourishing the skin. Protective Vitamin B3, the natural fruit acids extracts, and our proprietary essential oil blend leaves your skin feeling refreshed, cool and clean.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Rhassoul Clay (Moroccan Lava Clay), *Bentonite Clay, *Zea Mays (Corn) Starch, *Bamboo Activated Charcoal Powder, *Tapioca Starch, *Ascophyllum (Kelp Powder) Nodosum Powder, Calophyllum Inophyllum (Tamanu) Oil. Sodium Chloride (Dead Sea Salt), Niacinamide, Spearmint Oil, Lavender Oil, Rosmarinus Officinalis (Rosemary) Oil, Citrus Limonium (Lemon) Oil, Galangal Extract and Pure Essential Oils. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e45ML - Mix 1\/4 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation. 20ML - Mix 1\/8 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e30 ACTIVE INGREDIENTS IN JACQ'S GREEN SMOOTHIE ORGANIC FACE MASQUE \u0026amp; SCRUB\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e \u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"organic leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\" alt=\"oily\/combination skin, globe icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e","published_at":"2017-07-14T12:13:43-04:00","created_at":"2017-06-09T16:31:39-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["charcoal","essential oils","exfoliate","face scrub","green smoothie face mask","lavender","lemon","Moroccan","organic"],"price":1700,"price_min":1700,"price_max":2700,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636537923,"title":"2 oz","option1":"2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":30101985886256,"product_id":10500475139,"position":1,"created_at":"2022-07-07T16:01:43-04:00","updated_at":"2022-07-07T16:01:49-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","variant_ids":[40636537923]},"available":true,"name":"JACQ's Clarifying Green Smoothie Face Masque and Scrub - 2 oz","public_title":"2 oz","options":["2 oz"],"price":2700,"weight":71,"compare_at_price":null,"inventory_quantity":74,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":22439797260336,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":41905034243,"title":"45 ml","option1":"45 ml","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":30101999845424,"product_id":10500475139,"position":5,"created_at":"2022-07-07T16:05:04-04:00","updated_at":"2022-07-07T16:05:04-04:00","alt":null,"width":935,"height":1070,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304","variant_ids":[41905034243]},"available":true,"name":"JACQ's Clarifying Green Smoothie Face Masque and Scrub - 45 ml","public_title":"45 ml","options":["45 ml"],"price":1700,"weight":168,"compare_at_price":null,"inventory_quantity":129,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":22439813480496,"position":5,"preview_image":{"aspect_ratio":0.874,"height":1070,"width":935,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASKFRONT_9a207218-6f87-441f-a19a-3518ae6259bf.jpg?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask_1.png?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_face_mask_caasi1024X1024.jpg?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","options":["Size"],"media":[{"alt":null,"id":22439797260336,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","width":937},{"alt":null,"id":7584607666224,"position":2,"preview_image":{"aspect_ratio":0.874,"height":1067,"width":933,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASKFRONT_9a207218-6f87-441f-a19a-3518ae6259bf.jpg?v=1657224109"},"aspect_ratio":0.874,"height":1067,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASKFRONT_9a207218-6f87-441f-a19a-3518ae6259bf.jpg?v=1657224109","width":933},{"alt":null,"id":7584659111984,"position":3,"preview_image":{"aspect_ratio":0.874,"height":435,"width":380,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask_1.png?v=1657224109"},"aspect_ratio":0.874,"height":435,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask_1.png?v=1657224109","width":380},{"alt":"Black woman wearing JACQ's green smoothie face mask, drinking tea","id":435672875056,"position":4,"preview_image":{"aspect_ratio":1.0,"height":1024,"width":1024,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_face_mask_caasi1024X1024.jpg?v=1657224109"},"aspect_ratio":1.0,"height":1024,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_face_mask_caasi1024X1024.jpg?v=1657224109","width":1024},{"alt":null,"id":22439813480496,"position":5,"preview_image":{"aspect_ratio":0.874,"height":1070,"width":935,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304"},"aspect_ratio":0.874,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304","width":935}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Green Smoothie Organic Face Mask \u0026amp; Scrub with Charcoal and Sea Salt\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eIt's all about the face mask. JACQ's Green Smoothie Face Masque and Scrub aka Clarifying Mask contains an abundance of Minerals, Botanical Peptides and Rich Clays that work to help get oxygen into skin cells. Our blend of Montmorillonite Clay, Activated Charcoal, and Dead Sea Salt paired together with olive-derived Squalane to draw out impurities while nourishing the skin. Protective Vitamin B3, the natural fruit acids extracts, and our proprietary essential oil blend leaves your skin feeling refreshed, cool and clean.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Rhassoul Clay (Moroccan Lava Clay), *Bentonite Clay, *Zea Mays (Corn) Starch, *Bamboo Activated Charcoal Powder, *Tapioca Starch, *Ascophyllum (Kelp Powder) Nodosum Powder, Calophyllum Inophyllum (Tamanu) Oil. Sodium Chloride (Dead Sea Salt), Niacinamide, Spearmint Oil, Lavender Oil, Rosmarinus Officinalis (Rosemary) Oil, Citrus Limonium (Lemon) Oil, Galangal Extract and Pure Essential Oils. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e45ML - Mix 1\/4 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation. 20ML - Mix 1\/8 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e30 ACTIVE INGREDIENTS IN JACQ'S GREEN SMOOTHIE ORGANIC FACE MASQUE \u0026amp; SCRUB\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e \u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"organic leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\" alt=\"oily\/combination skin, globe icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e"}


We use cookies to improve our website and your shopping experience.By continuing to browse our site, you are consenting to our use of cookies. Read more about our Privacy Policy