Gifts & Sets

15 items
New Arrivals
Picked just for you.
Start shopping now.
JACQ's Beta-Acid Acne Treatment JACQ's Beta-Acid Acne Treatment
{"id":10500476675,"title":"JACQ's Beta-Acid Acne Treatment","handle":"the-high-priestess-beauty-booster","description":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-06-09T16:32:27-04:00","vendor":"JACQ'S","type":"Skin Care","tags":[],"price":1900,"price_min":1900,"price_max":1900,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636551619,"title":"1\/2 oz","option1":"1\/2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793009504304,"product_id":10500476675,"position":3,"created_at":"2021-08-09T15:23:56-04:00","updated_at":"2021-08-09T15:49:07-04:00","alt":null,"width":934,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","variant_ids":[40636551619]},"available":true,"name":"JACQ's Beta-Acid Acne Treatment - 1\/2 oz","public_title":"1\/2 oz","options":["1\/2 oz"],"price":1900,"weight":5,"compare_at_price":null,"inventory_quantity":138,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","options":["Size"],"media":[{"alt":null,"id":21058558591024,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058521497648,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"},"aspect_ratio":0.869,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","width":934},{"alt":null,"id":21058521464880,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e"}
{"id":10500480579,"title":"JACQ's PROBIOTIC FACE MASK","handle":"probiotic-face-mask-1","description":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:34-04:00","created_at":"2017-06-09T16:34:13-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","antioxidant","booster","Carrot","emollient","essential oils","Face Mask","face oil","face serum","jackfruit","moisturizer","papaya","protein","skin serum","vitamin E","yucca"],"price":2300,"price_min":2300,"price_max":2300,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636604483,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":29235789692976,"product_id":10500480579,"position":1,"created_at":"2021-12-15T14:18:06-05:00","updated_at":"2021-12-15T14:18:22-05:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902","variant_ids":[40636604483]},"available":true,"name":"JACQ's PROBIOTIC FACE MASK - 2oz","public_title":"2oz","options":["2oz"],"price":2300,"weight":85,"compare_at_price":null,"inventory_quantity":148,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21516283084848,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1639595902","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1639595902","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1639595902","\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsprobioticfacemask937x1075_efe4003d-666a-4729-8141-dcb8f6678803.jpg?v=1639595902"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902","options":["Size"],"media":[{"alt":null,"id":21516283084848,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1639595902","width":937},{"alt":null,"id":21058609020976,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1639595902"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1639595902","width":937},{"alt":null,"id":21058585428016,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1639595902"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1639595902","width":937},{"alt":null,"id":21058608988208,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1639595902"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1639595902","width":937},{"alt":null,"id":21058594865200,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsprobioticfacemask937x1075_efe4003d-666a-4729-8141-dcb8f6678803.jpg?v=1639595902"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsprobioticfacemask937x1075_efe4003d-666a-4729-8141-dcb8f6678803.jpg?v=1639595902","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's Drip Collection Skincare Bundle - Save $10
{"id":10612520899,"title":"JACQ's Drip Collection Skincare Bundle - Save $10","handle":"beauty-boosting-trio","description":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-11T19:04:44-04:00","created_at":"2017-07-09T17:02:19-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","beauty booster","booster","chamomile","face oil","face serum","moringa","protein","protein booster","skin serum","yucca"],"price":6500,"price_min":6500,"price_max":6500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42098492355,"title":"1","option1":"1","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793140805680,"product_id":10612520899,"position":1,"created_at":"2021-08-09T16:36:51-04:00","updated_at":"2021-08-09T16:39:03-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","variant_ids":[42098492355]},"available":true,"name":"JACQ's Drip Collection Skincare Bundle - Save $10 - 1","public_title":"1","options":["1"],"price":6500,"weight":5,"compare_at_price":null,"inventory_quantity":245,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","options":["1 Pack"],"media":[{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's Restorative Face Serum JACQ's Restorative Face Serum
{"id":10636301379,"title":"JACQ's Restorative Face Serum","handle":"jacqs-restorative-face-serum","description":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-07-14T13:01:45-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["amino acids","booster","chamomile","hibiscus","Moringa","plant nutrients","Vitamin A","Vitamin D"],"price":2400,"price_min":2400,"price_max":2400,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42338644867,"title":"1oz","option1":"1oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793074614320,"product_id":10636301379,"position":1,"created_at":"2021-08-09T16:11:09-04:00","updated_at":"2021-08-09T17:44:38-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","variant_ids":[42338644867]},"available":true,"name":"JACQ's Restorative Face Serum - 1oz","public_title":"1oz","options":["1oz"],"price":2400,"weight":5,"compare_at_price":null,"inventory_quantity":43,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","options":["Size"],"media":[{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","width":937},{"alt":null,"id":21058578481200,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","width":937},{"alt":null,"id":21058578513968,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","width":937},{"alt":null,"id":21058578546736,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e"}
JACQ's Beta-Acid Acne Treatment JACQ's Beta-Acid Acne Treatment
{"id":10500476675,"title":"JACQ's Beta-Acid Acne Treatment","handle":"the-high-priestess-beauty-booster","description":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-06-09T16:32:27-04:00","vendor":"JACQ'S","type":"Skin Care","tags":[],"price":1900,"price_min":1900,"price_max":1900,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636551619,"title":"1\/2 oz","option1":"1\/2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793009504304,"product_id":10500476675,"position":3,"created_at":"2021-08-09T15:23:56-04:00","updated_at":"2021-08-09T15:49:07-04:00","alt":null,"width":934,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","variant_ids":[40636551619]},"available":true,"name":"JACQ's Beta-Acid Acne Treatment - 1\/2 oz","public_title":"1\/2 oz","options":["1\/2 oz"],"price":1900,"weight":5,"compare_at_price":null,"inventory_quantity":138,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","options":["Size"],"media":[{"alt":null,"id":21058558591024,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058521497648,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"},"aspect_ratio":0.869,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","width":934},{"alt":null,"id":21058521464880,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e"}

JACQ's Beta-Acid Acne Treatment

$ 19.00
JACQ's Fruit Acid & Probiotics Skin Booster  PRODUCT INFO INGREDIENTS HOW TO USE Meet The High Priestess known for her abundance of Fruit Acid & AHA boosting ingredients. With over 20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple...
JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit
{"id":432966860829,"title":"JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit","handle":"heal-slay-kit-save-10","description":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Best-Selling Heal \u0026amp; Slay Vegan Skincare Trio: Face Cleanser, Toner, and Moisturizer\u003c\/span\u003e\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFORMATION\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHere's the perfect Heal and Slay Vegan Skincare Kit. This cruelty-free beauty kit contains our best sellers. Enjoy this magical trio including the JACQ's Healing Face Cleanser, Revitalizing Face Toner and Nourishing Face Moisturizer all work together to help you slay the day, that meeting, those exams or just to slay selfies. Slaying just got a lot easier!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e","published_at":"2017-07-11T19:04:06-04:00","created_at":"2018-03-08T15:45:59-05:00","vendor":"Jacq's Organics","type":"Gifts","tags":["bundle","coconut","CoQ10","face cleanser","face moisturizer","face toner","heal \u0026 slay kit","moringa","trio","yucca"],"price":7100,"price_min":7100,"price_max":7100,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":32324153049136,"title":"Full size","option1":"Full size","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit - Full size","public_title":"Full size","options":["Full size"],"price":7100,"weight":371,"compare_at_price":null,"inventory_quantity":162,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealandkitboxes.jpg?v=1649449002","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit.png?v=1649449002"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002","options":["Size:"],"media":[{"alt":null,"id":22002511708208,"position":1,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002","width":2048},{"alt":null,"id":21058647392304,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealandkitboxes.jpg?v=1649449002"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealandkitboxes.jpg?v=1649449002","width":937},{"alt":null,"id":21179951677488,"position":3,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit.png?v=1649449002"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit.png?v=1649449002","width":2048}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Best-Selling Heal \u0026amp; Slay Vegan Skincare Trio: Face Cleanser, Toner, and Moisturizer\u003c\/span\u003e\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFORMATION\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHere's the perfect Heal and Slay Vegan Skincare Kit. This cruelty-free beauty kit contains our best sellers. Enjoy this magical trio including the JACQ's Healing Face Cleanser, Revitalizing Face Toner and Nourishing Face Moisturizer all work together to help you slay the day, that meeting, those exams or just to slay selfies. Slaying just got a lot easier!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e"}

JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit

$ 71.00
JACQ's Best-Selling Heal & Slay Vegan Skincare Trio: Face Cleanser, Toner, and Moisturizer PRODUCT INFORMATION Here's the perfect Heal and Slay Vegan Skincare Kit. This cruelty-free beauty kit contains our best sellers. Enjoy this magical trio including the JACQ's Healing Face Cleanser, Revitalizing Face Toner and Nourishing Face Moisturizer all...
JACQ's Clear Essentials Skincare Kit
{"id":2155883003952,"title":"JACQ's Clear Essentials Skincare Kit","handle":"jacqs-skincare-holiday-gift-set","description":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Skincare Gift Set\u003c\/span\u003e\u003c\/h2\u003e\n\u003cbr\u003eGet healthy, radiant skin with this on the go glow essentials kit. Gently cleanse away dirt without stripping your skin of essential nutrients and moisture with our Healing Face Cleanser followed by our delicious Revitalizing Face Toner and tone your skin. Then hydrate and restore with our Balancing Face Serum packed with omega fatty acids to remedy breakouts and premature aging. Treat yourself to this magical trio. Slaying just got a lot easier!\u003cbr\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"Organic ingredients, leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\" alt=\"cruelty-free, cat icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e","published_at":"2017-07-11T19:04:06-04:00","created_at":"2018-11-23T09:39:24-05:00","vendor":"Jacq's Organics","type":"Gifts","tags":["cleanser","face cleanser","face serum","face toner","gift set","holiday gift set"],"price":7500,"price_min":7500,"price_max":7500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":21665727643696,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Clear Essentials Skincare Kit","public_title":null,"options":["Default Title"],"price":7500,"weight":283,"compare_at_price":null,"inventory_quantity":222,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197","options":["Title"],"media":[{"alt":null,"id":7584341229616,"position":1,"preview_image":{"aspect_ratio":0.87,"height":1071,"width":932,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197"},"aspect_ratio":0.87,"height":1071,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197","width":932}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Skincare Gift Set\u003c\/span\u003e\u003c\/h2\u003e\n\u003cbr\u003eGet healthy, radiant skin with this on the go glow essentials kit. Gently cleanse away dirt without stripping your skin of essential nutrients and moisture with our Healing Face Cleanser followed by our delicious Revitalizing Face Toner and tone your skin. Then hydrate and restore with our Balancing Face Serum packed with omega fatty acids to remedy breakouts and premature aging. Treat yourself to this magical trio. Slaying just got a lot easier!\u003cbr\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"Organic ingredients, leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\" alt=\"cruelty-free, cat icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e"}

JACQ's Clear Essentials Skincare Kit

$ 75.00
JACQ's Skincare Gift Set Get healthy, radiant skin with this on the go glow essentials kit. Gently cleanse away dirt without stripping your skin of essential nutrients and moisture with our Healing Face Cleanser followed by our delicious Revitalizing Face Toner and tone your skin. Then hydrate and restore with our Balancing...
JACQ's Detox and Glow Vegan Skincare Kit
{"id":10620877315,"title":"JACQ's Detox and Glow Vegan Skincare Kit","handle":"jacqs-detox-and-glow-vegan-skincare-kit","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eHere's your weekend detox and glow set. \u003c\/strong\u003eFor the days or night's when you just want to put on a mask and put your hair in a bun. \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/healing-face-cleanser-2\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Healing Face Cleanser\"\u003eHealing Face Cleanser\u003c\/a\u003e refreshes and purifies the skin with \u003cstrong\u003epeppermint, rosemary and papaya extract\u003c\/strong\u003e. While the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/clarifying-masque-and-scrub\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Clarifying Masque \u0026amp; Face Scrub\"\u003eClarifying Face Masque \u0026amp; Scrub \u003c\/a\u003edetoxifies your skin and feeds it \u003cstrong\u003eminerals and active ingredients\u003c\/strong\u003e. Spritz the cooling and refreshing\u003ca href=\"https:\/\/\/collections\/skin-care\/products\/revitalizing-face-toner-1\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's revitalizing toner \"\u003e Revitalizing Face Toner\u003c\/a\u003e enriched with \u003cstrong\u003eCoQ10\u003c\/strong\u003e to help minimize the appearance of pores then restore your glow with the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/antioxidant-infused-beauty-balm\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Moisturizing Antioxidant Beauty Balm\"\u003eMoisturizing Antioxidant Beauty Balm \u003c\/a\u003ethat nourishes and replenishes.\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"Vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" style=\"float: none;\"\u003e\u003cimg alt=\"Cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e","published_at":"2017-07-11T19:04:05-04:00","created_at":"2017-07-11T05:23:22-04:00","vendor":"Jacq's Organics ","type":"Gifts","tags":["beauty balm","bundle","cleanser","Face Mask","face scrub","face toner","gift set","skincare"],"price":10800,"price_min":10800,"price_max":10800,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42178827523,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Detox and Glow Vegan Skincare Kit","public_title":null,"options":["Default Title"],"price":10800,"weight":454,"compare_at_price":null,"inventory_quantity":218,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdetoxandglow2048x2048.png?v=1649449415"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdetoxandglow2048x2048.png?v=1649449415","options":["Title"],"media":[{"alt":null,"id":22002538020912,"position":1,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdetoxandglow2048x2048.png?v=1649449415"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdetoxandglow2048x2048.png?v=1649449415","width":2048}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eHere's your weekend detox and glow set. \u003c\/strong\u003eFor the days or night's when you just want to put on a mask and put your hair in a bun. \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/healing-face-cleanser-2\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Healing Face Cleanser\"\u003eHealing Face Cleanser\u003c\/a\u003e refreshes and purifies the skin with \u003cstrong\u003epeppermint, rosemary and papaya extract\u003c\/strong\u003e. While the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/clarifying-masque-and-scrub\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Clarifying Masque \u0026amp; Face Scrub\"\u003eClarifying Face Masque \u0026amp; Scrub \u003c\/a\u003edetoxifies your skin and feeds it \u003cstrong\u003eminerals and active ingredients\u003c\/strong\u003e. Spritz the cooling and refreshing\u003ca href=\"https:\/\/\/collections\/skin-care\/products\/revitalizing-face-toner-1\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's revitalizing toner \"\u003e Revitalizing Face Toner\u003c\/a\u003e enriched with \u003cstrong\u003eCoQ10\u003c\/strong\u003e to help minimize the appearance of pores then restore your glow with the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/antioxidant-infused-beauty-balm\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Moisturizing Antioxidant Beauty Balm\"\u003eMoisturizing Antioxidant Beauty Balm \u003c\/a\u003ethat nourishes and replenishes.\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"Vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" style=\"float: none;\"\u003e\u003cimg alt=\"Cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e"}

JACQ's Detox and Glow Vegan Skincare Kit

$ 108.00
JACQ's Vegan-Friendly Skincare Kit for All Skin Types WHAT IT IS: Here's your weekend detox and glow set. For the days or night's when you just want to put on a mask and put your hair in a bun. Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary...
2 jars of JACQ's detoxifying charcoal face mask & scrub Black woman using JACQ's detoxifying charcoal face mask
{"id":10620930819,"title":"JACQ's Detoxifying Face Mask \u0026 Scrub Duo","handle":"beat-face-duo","description":"\u003ch2\u003eJACQ'S Organic Moisturizing Face Mask for All Skin Types\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFORMATION\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eSay hello to your new selfie filter! Your selfie is 90% your skin. Achieve happy and clear skin with JACQ's organic face mask duo. Clarifying face mask \u0026amp; scrub to detoxify and unclog pores. Use our NEW Moisturizing face mask on days your skin feels and look a little dull to achieve that dewy glow.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003cimg alt=\"cruetly-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\n\u003c\/div\u003e","published_at":"2020-07-16T14:55:48-04:00","created_at":"2017-07-11T06:01:00-04:00","vendor":"Jacq's Organics ","type":"Face","tags":["charcoal","clarify","detoxify","Face Mask","face scrub","unclog pores"],"price":3000,"price_min":3000,"price_max":3000,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42180532547,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Detoxifying Face Mask \u0026 Scrub Duo","public_title":null,"options":["Default Title"],"price":3000,"weight":99,"compare_at_price":null,"inventory_quantity":203,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK2_e938d621-ca96-40f3-be22-ddb4d5695c0d.jpg?v=1596804947","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask.png?v=1596804932"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK2_e938d621-ca96-40f3-be22-ddb4d5695c0d.jpg?v=1596804947","options":["Title"],"media":[{"alt":"2 jars of JACQ's detoxifying charcoal face mask \u0026 scrub","id":7587724853296,"position":1,"preview_image":{"aspect_ratio":0.874,"height":1067,"width":933,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK2_e938d621-ca96-40f3-be22-ddb4d5695c0d.jpg?v=1596804947"},"aspect_ratio":0.874,"height":1067,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK2_e938d621-ca96-40f3-be22-ddb4d5695c0d.jpg?v=1596804947","width":933},{"alt":"Black woman using JACQ's detoxifying charcoal face mask ","id":7584690864176,"position":2,"preview_image":{"aspect_ratio":0.874,"height":435,"width":380,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask.png?v=1596804932"},"aspect_ratio":0.874,"height":435,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask.png?v=1596804932","width":380}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ'S Organic Moisturizing Face Mask for All Skin Types\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFORMATION\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eSay hello to your new selfie filter! Your selfie is 90% your skin. Achieve happy and clear skin with JACQ's organic face mask duo. Clarifying face mask \u0026amp; scrub to detoxify and unclog pores. Use our NEW Moisturizing face mask on days your skin feels and look a little dull to achieve that dewy glow.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\u003cimg alt=\"cruetly-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" style=\"float: none;\"\u003e\n\u003c\/div\u003e"}

JACQ's Detoxifying Face Mask & Scrub Duo

$ 30.00
JACQ'S Organic Moisturizing Face Mask for All Skin Types PRODUCT INFORMATION Say hello to your new selfie filter! Your selfie is 90% your skin. Achieve happy and clear skin with JACQ's organic face mask duo. Clarifying face mask & scrub to detoxify and unclog pores. Use our NEW Moisturizing face mask on days your skin...
JACQ's Dewy AF Vegan Skincare Kit
{"id":6564384309296,"title":"JACQ's Dewy AF Vegan Skincare Kit","handle":"jacqs-dewy-af-vegan-skincare-kit","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e Meet the newest set on the block. Our Nourishing Face Moisturizer and Hibiscus \u0026amp; Carrot Beauty Bar gently cleanse your face to treating acne breakouts and hydrate and treating bumpy skin and dryness\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"Vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" style=\"float: none;\"\u003e\u003cimg alt=\"Cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box.\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e","published_at":"2021-04-09T18:59:59-04:00","created_at":"2021-04-09T18:58:00-04:00","vendor":"Jacq's Organics","type":"Gifts","tags":["beauty balm","bundle","cleanser","Face Mask","face scrub","face toner","gift set","skincare"],"price":3500,"price_min":3500,"price_max":3500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39431386660912,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Dewy AF Vegan Skincare Kit","public_title":null,"options":["Default Title"],"price":3500,"weight":170,"compare_at_price":null,"inventory_quantity":23,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JACQScarrotmoisturizer.jpg?v=1618009165"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JACQScarrotmoisturizer.jpg?v=1618009165","options":["Title"],"media":[{"alt":null,"id":20473022087216,"position":1,"preview_image":{"aspect_ratio":0.878,"height":1067,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQScarrotmoisturizer.jpg?v=1618009165"},"aspect_ratio":0.878,"height":1067,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQScarrotmoisturizer.jpg?v=1618009165","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e Meet the newest set on the block. Our Nourishing Face Moisturizer and Hibiscus \u0026amp; Carrot Beauty Bar gently cleanse your face to treating acne breakouts and hydrate and treating bumpy skin and dryness\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"Vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" style=\"float: none;\"\u003e\u003cimg alt=\"Cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box.\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e"}

JACQ's Dewy AF Vegan Skincare Kit

$ 35.00
JACQ's Vegan-Friendly Skincare Kit for All Skin Types WHAT IT IS:  Meet the newest set on the block. Our Nourishing Face Moisturizer and Hibiscus & Carrot Beauty Bar gently cleanse your face to treating acne breakouts and hydrate and treating bumpy skin and dryness JACQ's DETOX & GLOW VEGAN SKINCARE...
JACQ's Drip Collection Skincare Bundle - Save $10
{"id":10612520899,"title":"JACQ's Drip Collection Skincare Bundle - Save $10","handle":"beauty-boosting-trio","description":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-11T19:04:44-04:00","created_at":"2017-07-09T17:02:19-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","beauty booster","booster","chamomile","face oil","face serum","moringa","protein","protein booster","skin serum","yucca"],"price":6500,"price_min":6500,"price_max":6500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42098492355,"title":"1","option1":"1","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793140805680,"product_id":10612520899,"position":1,"created_at":"2021-08-09T16:36:51-04:00","updated_at":"2021-08-09T16:39:03-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","variant_ids":[42098492355]},"available":true,"name":"JACQ's Drip Collection Skincare Bundle - Save $10 - 1","public_title":"1","options":["1"],"price":6500,"weight":5,"compare_at_price":null,"inventory_quantity":245,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","options":["1 Pack"],"media":[{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e"}

JACQ's Drip Collection Skincare Bundle - Save $10

$ 65.00
JACQ's Certified Organic Beauty Booster Skin Serum Pack of 3  PRODUCT INFO INGREDIENTS HOW TO USE We get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal...
{"id":6547807830064,"title":"JACQ'S EASY PEASEY SKINCARE SLAY KIT","handle":"jacqs-easy-peasey-skincare-slay-kit","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eGet your self-care on, sis!  Indulge and enjoy a session of masking, messy bun, and a delicious moisturizer, lol.  The Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary, and papaya extract. While the Clarifying Face Masque \u0026amp; Scrub detoxifies your skin and feeds it minerals and active ingredients. Bring it all together with our delicious peptide-packed Nourishing Face Moisturizer to seal in all the moisture and restore that glow! Perfect for the skincare junkie and the lazy skincare queens.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"all skin types, pink icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cstrong\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" alt=\"Vegan-friendly, bird icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" alt=\"Cruelty-free, monkey icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" alt=\"organic ingredients, leaf icon\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e","published_at":"2021-03-17T16:31:19-04:00","created_at":"2021-03-17T16:01:37-04:00","vendor":"Jacq's Organics","type":"Gifts","tags":["beauty balm","bundle","cleanser","Face Mask","face scrub","face toner","gift set","skincare"],"price":7000,"price_min":7000,"price_max":7000,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39334934806576,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S EASY PEASEY SKINCARE SLAY KIT","public_title":null,"options":["Default Title"],"price":7000,"weight":454,"compare_at_price":null,"inventory_quantity":68,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareeasypeasy2048x2048.png?v=1649449639","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealingfacecleanserandclarifyingfacemask937x1075.jpg?v=1649449639","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075.jpg?v=1649449639"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareeasypeasy2048x2048.png?v=1649449639","options":["Title"],"media":[{"alt":null,"id":22002555289648,"position":1,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareeasypeasy2048x2048.png?v=1649449639"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareeasypeasy2048x2048.png?v=1649449639","width":2048},{"alt":null,"id":21058657419312,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealingfacecleanserandclarifyingfacemask937x1075.jpg?v=1649449639"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealingfacecleanserandclarifyingfacemask937x1075.jpg?v=1649449639","width":937},{"alt":null,"id":21058657517616,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075.jpg?v=1649449639"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075.jpg?v=1649449639","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eGet your self-care on, sis!  Indulge and enjoy a session of masking, messy bun, and a delicious moisturizer, lol.  The Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary, and papaya extract. While the Clarifying Face Masque \u0026amp; Scrub detoxifies your skin and feeds it minerals and active ingredients. Bring it all together with our delicious peptide-packed Nourishing Face Moisturizer to seal in all the moisture and restore that glow! Perfect for the skincare junkie and the lazy skincare queens.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"all skin types, pink icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cstrong\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" alt=\"Vegan-friendly, bird icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" alt=\"Cruelty-free, monkey icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" alt=\"organic ingredients, leaf icon\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e"}


$ 70.00
JACQ's Vegan-Friendly Skincare Kit for All Skin Types WHAT IT IS: Get your self-care on, sis!  Indulge and enjoy a session of masking, messy bun, and a delicious moisturizer, lol.  The Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary, and papaya extract. While the Clarifying Face Masque...
JACQ's pink beauty & bath bar packaging x 3 Black woman holding 2 JACQ's beauty bars, charcoal, and beige
{"id":440322588701,"title":"JACQ's Exfoliating Beauty Bar Trio","handle":"beauty-bar-trio","description":"\u003ch2\u003eCleanse, Exfoliate, and Detoxify with JACQ'S Beauty Bar Set\u003c\/h2\u003e\n\u003cp\u003eWho said the only way to detox is by drinking a smoothie, detoxing, or sipping on tea? Here's the perfect way to cleanse, exfoliate, and detox your skin from the outside in. With JACQ's Beauty Bar Set, each bar formulated to help remove dirt, grime, and oils from your skin. The collections come with:\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e\u003cspan\u003e1- 2oz Plantain \u0026amp; Charcoal Beauty Bar\u003c\/span\u003e\u003c\/li\u003e\n\u003cli\u003e\u003cspan\u003e\u003cspan\u003e1- 2oz Hibiscus \u0026amp; Wild Carrot Beauty Bar\u003c\/span\u003e\u003c\/span\u003e\u003c\/li\u003e\n\u003cli\u003e\u003cspan\u003e\u003cspan\u003e1- 2oz Lavender \u0026amp; Yucca Beauty Bar\u003c\/span\u003e\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan\u003e\u003cspan\u003e*Pick any variation of the soap bars. Leave a comment at checkout explaining which bars you'd like to include in your order.\u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eHow to Use JACQ's Beauty Bars:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eSee individual product pages for instructions.\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_31a31d7b-01a1-4771-944c-1f6f542a5ac3_compact.jpg?v=1519958948\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"organic ingredients, plant icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\n\u003c\/div\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eShips in 1-2 business days.\u003c\/p\u003e","published_at":"2018-03-13T11:07:54-04:00","created_at":"2018-03-13T10:52:38-04:00","vendor":"Jacq's","type":"Gifts","tags":["beauty bar","bundle","carrot","charcoal","gift set","hibiscus","lavender","plantain","yucca"],"price":1750,"price_min":1750,"price_max":3800,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":5927684997149,"title":"4oz Beauty Bars","option1":"4oz Beauty Bars","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15388810281008,"product_id":440322588701,"position":1,"created_at":"2020-07-16T08:20:06-04:00","updated_at":"2021-09-23T12:53:34-04:00","alt":"JACQ's pink beauty \u0026 bath bar packaging x 3","width":934,"height":1002,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014","variant_ids":[5927684997149]},"available":false,"name":"JACQ's Exfoliating Beauty Bar Trio - 4oz Beauty Bars","public_title":"4oz Beauty Bars","options":["4oz Beauty Bars"],"price":3800,"weight":170,"compare_at_price":null,"inventory_quantity":0,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":"JACQ's pink beauty \u0026 bath bar packaging x 3","id":7562204774448,"position":1,"preview_image":{"aspect_ratio":0.932,"height":1002,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":32324163436592,"title":"2oz Beauty Bars","option1":"2oz Beauty Bars","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":1836903301149,"product_id":440322588701,"position":4,"created_at":"2018-03-20T15:41:27-04:00","updated_at":"2021-09-23T12:53:34-04:00","alt":"stack of JACQ's organic beauty bars","width":1280,"height":1920,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_charcoal_soap3.jpg?v=1632416014","variant_ids":[32324163436592]},"available":true,"name":"JACQ's Exfoliating Beauty Bar Trio - 2oz Beauty Bars","public_title":"2oz Beauty Bars","options":["2oz Beauty Bars"],"price":1750,"weight":170,"compare_at_price":null,"inventory_quantity":263,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":"stack of JACQ's organic beauty bars","id":813445283888,"position":4,"preview_image":{"aspect_ratio":0.667,"height":1920,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_charcoal_soap3.jpg?v=1632416014"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_organics_soap_bundle_2018.jpg?v=1632416014","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit1.png?v=1632416003","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_charcoal_soap3.jpg?v=1632416014"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014","options":["Beauty Bars Trio"],"media":[{"alt":"JACQ's pink beauty \u0026 bath bar packaging x 3","id":7562204774448,"position":1,"preview_image":{"aspect_ratio":0.932,"height":1002,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014"},"aspect_ratio":0.932,"height":1002,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014","width":934},{"alt":"Black woman holding 2 JACQ's beauty bars, charcoal, and beige","id":1015855448112,"position":2,"preview_image":{"aspect_ratio":0.768,"height":1666,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_organics_soap_bundle_2018.jpg?v=1632416014"},"aspect_ratio":0.768,"height":1666,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_organics_soap_bundle_2018.jpg?v=1632416014","width":1280},{"alt":null,"id":21180004237360,"position":3,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit1.png?v=1632416003"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit1.png?v=1632416003","width":2048},{"alt":"stack of JACQ's organic beauty bars","id":813445283888,"position":4,"preview_image":{"aspect_ratio":0.667,"height":1920,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_charcoal_soap3.jpg?v=1632416014"},"aspect_ratio":0.667,"height":1920,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_charcoal_soap3.jpg?v=1632416014","width":1280}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eCleanse, Exfoliate, and Detoxify with JACQ'S Beauty Bar Set\u003c\/h2\u003e\n\u003cp\u003eWho said the only way to detox is by drinking a smoothie, detoxing, or sipping on tea? Here's the perfect way to cleanse, exfoliate, and detox your skin from the outside in. With JACQ's Beauty Bar Set, each bar formulated to help remove dirt, grime, and oils from your skin. The collections come with:\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e\u003cspan\u003e1- 2oz Plantain \u0026amp; Charcoal Beauty Bar\u003c\/span\u003e\u003c\/li\u003e\n\u003cli\u003e\u003cspan\u003e\u003cspan\u003e1- 2oz Hibiscus \u0026amp; Wild Carrot Beauty Bar\u003c\/span\u003e\u003c\/span\u003e\u003c\/li\u003e\n\u003cli\u003e\u003cspan\u003e\u003cspan\u003e1- 2oz Lavender \u0026amp; Yucca Beauty Bar\u003c\/span\u003e\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan\u003e\u003cspan\u003e*Pick any variation of the soap bars. Leave a comment at checkout explaining which bars you'd like to include in your order.\u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eHow to Use JACQ's Beauty Bars:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eSee individual product pages for instructions.\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_31a31d7b-01a1-4771-944c-1f6f542a5ac3_compact.jpg?v=1519958948\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"organic ingredients, plant icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\n\u003c\/div\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eShips in 1-2 business days.\u003c\/p\u003e"}

JACQ's Exfoliating Beauty Bar Trio

$ 17.50
Cleanse, Exfoliate, and Detoxify with JACQ'S Beauty Bar Set Who said the only way to detox is by drinking a smoothie, detoxing, or sipping on tea? Here's the perfect way to cleanse, exfoliate, and detox your skin from the outside in. With JACQ's Beauty Bar Set, each bar formulated to help remove...
JACQ's Revitalizing Face Toner & Face Scrub duo
{"id":10620880387,"title":"JACQ'S Glow Getter Face Toner \u0026 Mask Bundle - Save $5","handle":"glow-getter-skincare-set","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Beta-Carotene \u0026amp; Minerals Face Toner \u0026amp; Face Mask Skincare Bundle\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eThe root of a carrot contains 89% water. This magical plant is high in Beta-carotene, Minerals and Vitamins A, B, C and E. \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/revitalizing-face-toner-1\" target=\"_blank\" rel=\"noopener noreferrer\"\u003eRevitalizing Face Toner\u003c\/a\u003e is infused with cell regenerative CoEnzyme paired with the oily-absorbing \u003ca href=\"https:\/\/\/collections\/normal-skin\/products\/clarifying-masque-and-scrub\" target=\"_blank\" rel=\"noopener noreferrer\"\u003eClarifying Face Masque \u0026amp; Scrub\u003c\/a\u003e it's the perfect low maintenance treatment. Sprinkled in with sweet floral Rose Geranium and our signature plant infusion. The result is soft, hydrated and supple skin. \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eDETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types pink hand icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_small.jpg?v=1499303284\" alt=\"vegan friendly bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_small.jpg?v=1499296925\" alt=\"cruelty free cat icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" alt=\"organic ingredients leaf icon\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready set\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e","published_at":"2017-07-11T19:04:06-04:00","created_at":"2017-07-11T05:25:06-04:00","vendor":"Jacq's Organics","type":"Gifts","tags":["beta-carotene","cell regeneration","Face Mask","face scrub","Geranium","toner","Vitamin A","Vitamin B","Vitamin C","Vitamin E"],"price":4500,"price_min":4500,"price_max":4500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42178887299,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S Glow Getter Face Toner \u0026 Mask Bundle - Save $5","public_title":null,"options":["Default Title"],"price":4500,"weight":227,"compare_at_price":null,"inventory_quantity":-43,"inventory_management":null,"inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/glowgetter.jpg?v=1596329447"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/glowgetter.jpg?v=1596329447","options":["Title"],"media":[{"alt":"JACQ's Revitalizing Face Toner \u0026 Face Scrub duo","id":7587633397808,"position":1,"preview_image":{"aspect_ratio":0.87,"height":1074,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/glowgetter.jpg?v=1596329447"},"aspect_ratio":0.87,"height":1074,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/glowgetter.jpg?v=1596329447","width":934}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Beta-Carotene \u0026amp; Minerals Face Toner \u0026amp; Face Mask Skincare Bundle\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eThe root of a carrot contains 89% water. This magical plant is high in Beta-carotene, Minerals and Vitamins A, B, C and E. \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/revitalizing-face-toner-1\" target=\"_blank\" rel=\"noopener noreferrer\"\u003eRevitalizing Face Toner\u003c\/a\u003e is infused with cell regenerative CoEnzyme paired with the oily-absorbing \u003ca href=\"https:\/\/\/collections\/normal-skin\/products\/clarifying-masque-and-scrub\" target=\"_blank\" rel=\"noopener noreferrer\"\u003eClarifying Face Masque \u0026amp; Scrub\u003c\/a\u003e it's the perfect low maintenance treatment. Sprinkled in with sweet floral Rose Geranium and our signature plant infusion. The result is soft, hydrated and supple skin. \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eDETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types pink hand icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_small.jpg?v=1499303284\" alt=\"vegan friendly bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_small.jpg?v=1499296925\" alt=\"cruelty free cat icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" alt=\"organic ingredients leaf icon\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready set\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e"}

JACQ'S Glow Getter Face Toner & Mask Bundle - Save $5

$ 45.00
JACQ's Beta-Carotene & Minerals Face Toner & Face Mask Skincare Bundle WHAT IT IS: The root of a carrot contains 89% water. This magical plant is high in Beta-carotene, Minerals and Vitamins A, B, C and E. Revitalizing Face Toner is infused with cell regenerative CoEnzyme paired with the oily-absorbing...
JACQ's Mini Heal + Slay Kit Skincare Bundle JACQ's mini heal & slay kit bundles x 3, 3 bottles
{"id":319129649181,"title":"JACQ's Mini Heal + Slay Kit Skincare Bundle","handle":"mini-heal-and-slay-skincare-kit","description":"\u003ch2\u003eJACQ's Vegan \u0026amp; Organic Travel-Size Skincare Bundle\u003c\/h2\u003e\n\u003cp\u003eHere's the perfect slay kit. \u003cspan\u003eThis JACQ's travel-size beauty kit contains vegan and organic ingredients. The skincare gift set contains one JACQ's healing face cleanser, one hydrating face toner, and one replenishing face moisturizer. Each available in a convenient travel size. TSA approved, this kit makes for a perfect getaway or as a sample kit. Slaying just got a lot easier!\u003c\/span\u003e\u003c\/p\u003e","published_at":"2017-11-27T10:16:30-05:00","created_at":"2017-11-27T10:36:56-05:00","vendor":"Jacq's","type":"Skin Care","tags":["face cleanser","face moisturizer","face toner","mini","skincare bundle","travel size","TSA approved"],"price":2500,"price_min":2500,"price_max":2500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":32324169859120,"title":"Full size","option1":"Full size","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Mini Heal + Slay Kit Skincare Bundle - Full size","public_title":"Full size","options":["Full size"],"price":2500,"weight":170,"compare_at_price":null,"inventory_quantity":305,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizermini2048x2048.png?v=1649429884","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsMINIhealandslaykit.jpg?v=1649429884","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsminihealandslaykitback.jpg?v=1649429884"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizermini2048x2048.png?v=1649429884","options":["Full size"],"media":[{"alt":null,"id":22001462050864,"position":1,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizermini2048x2048.png?v=1649429884"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizermini2048x2048.png?v=1649429884","width":2048},{"alt":"JACQ's mini heal \u0026 slay kit bundles x 3, 3 bottles","id":7561852518448,"position":2,"preview_image":{"aspect_ratio":0.87,"height":1075,"width":935,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsMINIhealandslaykit.jpg?v=1649429884"},"aspect_ratio":0.87,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsMINIhealandslaykit.jpg?v=1649429884","width":935},{"alt":"JACQ's mini heal \u0026 slay kit bundle, ingredients labels","id":7561853632560,"position":3,"preview_image":{"aspect_ratio":0.871,"height":1069,"width":931,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsminihealandslaykitback.jpg?v=1649429884"},"aspect_ratio":0.871,"height":1069,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsminihealandslaykitback.jpg?v=1649429884","width":931}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Vegan \u0026amp; Organic Travel-Size Skincare Bundle\u003c\/h2\u003e\n\u003cp\u003eHere's the perfect slay kit. \u003cspan\u003eThis JACQ's travel-size beauty kit contains vegan and organic ingredients. The skincare gift set contains one JACQ's healing face cleanser, one hydrating face toner, and one replenishing face moisturizer. Each available in a convenient travel size. TSA approved, this kit makes for a perfect getaway or as a sample kit. Slaying just got a lot easier!\u003c\/span\u003e\u003c\/p\u003e"}

JACQ's Mini Heal + Slay Kit Skincare Bundle

$ 25.00
JACQ's Vegan & Organic Travel-Size Skincare Bundle Here's the perfect slay kit. This JACQ's travel-size beauty kit contains vegan and organic ingredients. The skincare gift set contains one JACQ's healing face cleanser, one hydrating face toner, and one replenishing face moisturizer. Each available in a convenient travel size. TSA approved, this kit...
JACQ'S Operation Glow 4.0 Skincare Bundle JACQ'S Operation Glow 4.0 Skincare Bundle
{"id":10620931907,"title":"JACQ'S Operation Glow 4.0 Skincare Bundle","handle":"jacqs-operation-glow-skincare-kit","description":"\u003ch2\u003eJACQ's Skincare Bundle For All Skin Types, 6 products\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThe coalition effect, known as Operation Glow 4.0, benefits all skin types. all ages and myriad of dynamic women looking to restore her glow. This is the ultimate coalition force if you are looking for the ultimate glow. Armed with our decadent and moisturizing Antioxidant Beauty Balm that doubles as a cleanser and replenishes skin, followed by our Revitalizing Floral Face Toner that minimizes the appearance of pores, then reward your skin with our light-weight face serum that hydrates skin with potent plant nutrients. For that extra boost, layer on our Nourishing Face Moisturizer to reveal your best glow yet.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT YOU CAN EXPECT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e1 Replenishing Face Serum \u003c\/li\u003e\n\u003cli\u003e1 Healing Face Cleanser\u003c\/li\u003e\n\u003cli\u003e1 Revitalizing Face Toner \u003c\/li\u003e\n\u003cli\u003e1 Nourishing Face Moisturizer\u003c\/li\u003e\n\u003cli\u003e1 Antioxidant Beauty Balm \u003c\/li\u003e\n\u003cli\u003e1 Clarifying Face Masque \u0026amp; Scrub\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003ePackaged in a gift-ready box\u003cbr\u003e*See links for full list of ingredients, benefits, uses and directions++\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-11T19:05:40-04:00","created_at":"2017-07-11T06:01:51-04:00","vendor":"Jacq's Organics","type":"Gifts","tags":["beauty balm","bundle","face cleanser","Face Mask","face moisturizer","face serum","face toner","skincare bundle"],"price":22000,"price_min":22000,"price_max":22000,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42180577411,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S Operation Glow 4.0 Skincare Bundle","public_title":null,"options":["Default Title"],"price":22000,"weight":227,"compare_at_price":null,"inventory_quantity":266,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/","\/\/\/s\/files\/1\/0877\/4074\/products\/","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsoperationsglowset.jpg?v=1628545296"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/","options":["Title"],"media":[{"alt":null,"id":21058755625008,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/","width":937},{"alt":null,"id":21058756378672,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/","width":937},{"alt":"6 JACQ's skincare products, Operation Glow 4.0","id":7562730012720,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1071,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsoperationsglowset.jpg?v=1628545296"},"aspect_ratio":0.872,"height":1071,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsoperationsglowset.jpg?v=1628545296","width":934}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Skincare Bundle For All Skin Types, 6 products\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThe coalition effect, known as Operation Glow 4.0, benefits all skin types. all ages and myriad of dynamic women looking to restore her glow. This is the ultimate coalition force if you are looking for the ultimate glow. Armed with our decadent and moisturizing Antioxidant Beauty Balm that doubles as a cleanser and replenishes skin, followed by our Revitalizing Floral Face Toner that minimizes the appearance of pores, then reward your skin with our light-weight face serum that hydrates skin with potent plant nutrients. For that extra boost, layer on our Nourishing Face Moisturizer to reveal your best glow yet.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT YOU CAN EXPECT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e1 Replenishing Face Serum \u003c\/li\u003e\n\u003cli\u003e1 Healing Face Cleanser\u003c\/li\u003e\n\u003cli\u003e1 Revitalizing Face Toner \u003c\/li\u003e\n\u003cli\u003e1 Nourishing Face Moisturizer\u003c\/li\u003e\n\u003cli\u003e1 Antioxidant Beauty Balm \u003c\/li\u003e\n\u003cli\u003e1 Clarifying Face Masque \u0026amp; Scrub\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003ePackaged in a gift-ready box\u003cbr\u003e*See links for full list of ingredients, benefits, uses and directions++\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e"}

JACQ'S Operation Glow 4.0 Skincare Bundle

$ 220.00
JACQ's Skincare Bundle For All Skin Types, 6 products PRODUCT INFO The coalition effect, known as Operation Glow 4.0, benefits all skin types. all ages and myriad of dynamic women looking to restore her glow. This is the ultimate coalition force if you are looking for the ultimate glow. Armed...
Showing items 1 - 12 of 15
We use cookies to improve our website and your shopping experience.By continuing to browse our site, you are consenting to our use of cookies. Read more about our Privacy Policy