Malassezia Folliculitis

7 items
New Arrivals
Picked just for you.
Start shopping now.
JACQ's Beta-Acid Acne Treatment JACQ's Beta-Acid Acne Treatment
{"id":10500476675,"title":"JACQ's Beta-Acid Acne Treatment","handle":"the-high-priestess-beauty-booster","description":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-06-09T16:32:27-04:00","vendor":"JACQ'S","type":"Skin Care","tags":[],"price":1900,"price_min":1900,"price_max":1900,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636551619,"title":"1\/2 oz","option1":"1\/2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793009504304,"product_id":10500476675,"position":3,"created_at":"2021-08-09T15:23:56-04:00","updated_at":"2021-08-09T15:49:07-04:00","alt":null,"width":934,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","variant_ids":[40636551619]},"available":true,"name":"JACQ's Beta-Acid Acne Treatment - 1\/2 oz","public_title":"1\/2 oz","options":["1\/2 oz"],"price":1900,"weight":5,"compare_at_price":null,"inventory_quantity":131,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","options":["Size"],"media":[{"alt":null,"id":21058558591024,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058521497648,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"},"aspect_ratio":0.869,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","width":934},{"alt":null,"id":21058521464880,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e"}
{"id":10500480579,"title":"JACQ's PROBIOTIC FACE MASK","handle":"probiotic-face-mask-1","description":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:34-04:00","created_at":"2017-06-09T16:34:13-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","antioxidant","booster","Carrot","emollient","essential oils","Face Mask","face oil","face serum","jackfruit","moisturizer","papaya","protein","skin serum","vitamin E","yucca"],"price":2300,"price_min":2300,"price_max":2300,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636604483,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":29235789692976,"product_id":10500480579,"position":2,"created_at":"2021-12-15T14:18:06-05:00","updated_at":"2022-07-07T16:10:34-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","variant_ids":[40636604483]},"available":true,"name":"JACQ's PROBIOTIC FACE MASK - 2oz","public_title":"2oz","options":["2oz"],"price":2300,"weight":85,"compare_at_price":null,"inventory_quantity":143,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21516283084848,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","options":["Size"],"media":[{"alt":null,"id":22439844610096,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","width":937},{"alt":null,"id":21516283084848,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","width":937},{"alt":null,"id":21058609020976,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634","width":937},{"alt":null,"id":21058585428016,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634","width":937},{"alt":null,"id":21058608988208,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634","width":937},{"alt":null,"id":22439843332144,"position":6,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's Drip Collection Skincare Bundle - Save $10
{"id":10612520899,"title":"JACQ's Drip Collection Skincare Bundle - Save $10","handle":"beauty-boosting-trio","description":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-11T19:04:44-04:00","created_at":"2017-07-09T17:02:19-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","beauty booster","booster","chamomile","face oil","face serum","moringa","protein","protein booster","skin serum","yucca"],"price":6500,"price_min":6500,"price_max":6500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42098492355,"title":"1","option1":"1","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793140805680,"product_id":10612520899,"position":1,"created_at":"2021-08-09T16:36:51-04:00","updated_at":"2021-08-09T16:39:03-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","variant_ids":[42098492355]},"available":true,"name":"JACQ's Drip Collection Skincare Bundle - Save $10 - 1","public_title":"1","options":["1"],"price":6500,"weight":5,"compare_at_price":null,"inventory_quantity":244,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","options":["1 Pack"],"media":[{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's Restorative Face Serum JACQ's Restorative Face Serum
{"id":10636301379,"title":"JACQ's Restorative Face Serum","handle":"jacqs-restorative-face-serum","description":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-07-14T13:01:45-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["amino acids","booster","chamomile","hibiscus","Moringa","plant nutrients","Vitamin A","Vitamin D"],"price":2400,"price_min":2400,"price_max":2400,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42338644867,"title":"1oz","option1":"1oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793074614320,"product_id":10636301379,"position":1,"created_at":"2021-08-09T16:11:09-04:00","updated_at":"2021-08-09T17:44:38-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","variant_ids":[42338644867]},"available":true,"name":"JACQ's Restorative Face Serum - 1oz","public_title":"1oz","options":["1oz"],"price":2400,"weight":5,"compare_at_price":null,"inventory_quantity":37,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","options":["Size"],"media":[{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","width":937},{"alt":null,"id":21058578481200,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","width":937},{"alt":null,"id":21058578513968,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","width":937},{"alt":null,"id":21058578546736,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e"}
JACQ'S Revitalizing Face Toner JACQ'S Revitalizing Face Toner
{"id":10471658243,"title":"JACQ'S Revitalizing Face Toner","handle":"revitalizing-face-toner","description":"\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eA\u003cstrong\u003e hydrating floral tea for your skin\u003c\/strong\u003e formulated with refreshing Mint, toning and moisturizing \u003cstrong\u003eHibiscus pedals and healing Burdock Root\u003c\/strong\u003e. A perfect blend of herbal extracts,\u003cstrong\u003e fatty acids, and vitamins\u003c\/strong\u003e, this toner was crafted to\u003cstrong\u003e restores skin pH balance. minimize the appearance of pores, tone and remove excess residue from makeup, dirt, and oils\u003c\/strong\u003e.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003eWater (Aqua), *Hibiscus Rosa Sinensis Linn (Hibiscus), *Mentha Citrus Sinensis (Orange Mint), Rosa Centifolia (Rose), *Prunus Amygdalus Dulcis (Sweet Almond) Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Arctium Lappa (Burdock) Extract, *Echinacea Purpurea Extract, *Rumex (Yellow Dock) Crispus Extract, *Chamomilla Recutita (Matricaria) Extract, *Rosa Moschata (Rosehip) Seed Oil, Hippophae Rhamnoides (Sea Buckthorn) Seed Oil, *Aloe Barbadensis Extract, Ubiquinone (CoQ10), Leucidal Liquid (Radish Root Ferment) and Pure Essential Oils . *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eAfter cleansing, moisten a cotton pad with the toner and gently wipe across the forehead, cheek, and throat in an upward with outward motions. Avoid eye area.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"color: #0b5394;\"\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003eBurdock Root \u003c\/b\u003econtains ingredients known for cleansing the lymphatic system. It's antifungal and antibacterial and an ideal ingredient for regulating oil production in the skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eCoQ10 \u003c\/b\u003eacts as an antioxidant, energizes your skin and helps improves skin elasticity.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eHibiscus\u003c\/strong\u003e is a natural astringent rich in calcium, magnesium, and iron. A cooling and refreshing source of vegetable acids and vitamins A, B6, B12,, 12 C \u0026amp; D. Great for acne and oily combination skin.\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:33-04:00","created_at":"2017-06-01T21:34:06-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["probiotics"],"price":2499,"price_min":2499,"price_max":2499,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40244950211,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15388612362288,"product_id":10471658243,"position":1,"created_at":"2020-07-16T07:34:52-04:00","updated_at":"2020-07-16T07:34:54-04:00","alt":null,"width":934,"height":1064,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","variant_ids":[40244950211]},"available":true,"name":"JACQ'S Revitalizing Face Toner - 2oz","public_title":"2oz","options":["2oz"],"price":2499,"weight":85,"compare_at_price":null,"inventory_quantity":93,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":7562006659120,"position":1,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsfacetoner937x1075.png?v=1657226523","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerfront.jpg?v=1657226523"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","options":["Size"],"media":[{"alt":null,"id":7562006659120,"position":1,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294"},"aspect_ratio":0.878,"height":1064,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","width":934},{"alt":null,"id":22440012349488,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsfacetoner937x1075.png?v=1657226523"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsfacetoner937x1075.png?v=1657226523","width":937},{"alt":null,"id":7562005446704,"position":3,"preview_image":{"aspect_ratio":0.871,"height":1070,"width":932,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerfront.jpg?v=1657226523"},"aspect_ratio":0.871,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerfront.jpg?v=1657226523","width":932}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eA\u003cstrong\u003e hydrating floral tea for your skin\u003c\/strong\u003e formulated with refreshing Mint, toning and moisturizing \u003cstrong\u003eHibiscus pedals and healing Burdock Root\u003c\/strong\u003e. A perfect blend of herbal extracts,\u003cstrong\u003e fatty acids, and vitamins\u003c\/strong\u003e, this toner was crafted to\u003cstrong\u003e restores skin pH balance. minimize the appearance of pores, tone and remove excess residue from makeup, dirt, and oils\u003c\/strong\u003e.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003eWater (Aqua), *Hibiscus Rosa Sinensis Linn (Hibiscus), *Mentha Citrus Sinensis (Orange Mint), Rosa Centifolia (Rose), *Prunus Amygdalus Dulcis (Sweet Almond) Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Arctium Lappa (Burdock) Extract, *Echinacea Purpurea Extract, *Rumex (Yellow Dock) Crispus Extract, *Chamomilla Recutita (Matricaria) Extract, *Rosa Moschata (Rosehip) Seed Oil, Hippophae Rhamnoides (Sea Buckthorn) Seed Oil, *Aloe Barbadensis Extract, Ubiquinone (CoQ10), Leucidal Liquid (Radish Root Ferment) and Pure Essential Oils . *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eAfter cleansing, moisten a cotton pad with the toner and gently wipe across the forehead, cheek, and throat in an upward with outward motions. Avoid eye area.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"color: #0b5394;\"\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003eBurdock Root \u003c\/b\u003econtains ingredients known for cleansing the lymphatic system. It's antifungal and antibacterial and an ideal ingredient for regulating oil production in the skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eCoQ10 \u003c\/b\u003eacts as an antioxidant, energizes your skin and helps improves skin elasticity.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eHibiscus\u003c\/strong\u003e is a natural astringent rich in calcium, magnesium, and iron. A cooling and refreshing source of vegetable acids and vitamins A, B6, B12,, 12 C \u0026amp; D. Great for acne and oily combination skin.\u003c\/li\u003e\n\u003c\/ul\u003e"}

JACQ'S Revitalizing Face Toner

$ 24.99
PRODUCT INFO INGREDIENTS HOW TO USE A hydrating floral tea for your skin formulated with refreshing Mint, toning and moisturizing Hibiscus pedals and healing Burdock Root. A perfect blend of herbal extracts, fatty acids, and vitamins, this toner was crafted to restores skin pH balance. minimize the appearance of pores,...
JACQ's Wild Hibiscus & Carrot Cleansing Bar JACQ's hibiscus & carrot cleansing bar, pink packaging
{"id":648924995,"title":"JACQ's Wild Hibiscus \u0026 Carrot Cleansing Bar","handle":"hibiscus-carrot-cleansing-bar","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Certified Organic Moisturizing Rice Milk \u0026amp; Aloe Vera Soap Bar\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT IS IT?\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003eOrganic carrots, organic rice milk, and moisturizing Aloe vera in each and every batch of our carrot con Leche cleansing bars. The results are skin moisturizing, blemish fighting soft bubble producing dirt fighting goodness. Got annoying blemishes on your back and arms? Aging is an issue? Or your skin is really sensitive? Then JACQ's has you covered. Give our organic cleansing bar a try. Did we mention, it won't dry your skin out.  AVAILABLE IN A SMALLER SIZE. \u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eDETAILS:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_small.jpg?v=1499303284\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_small.jpg?v=1499297299\" alt=\"cruelty free, bunny icon\" style=\"float: none;\"\u003e  \u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" alt=\"organic ingredients, leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\" alt=\"handmade small batches, unicorn icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003eWHAT'S IN JACQ's HIBISCUS \u0026amp; CARROT CLEANSING BAR:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003eSaponified oils of Cocos Nucifera (Coconut) Oil, Helianthus Annuus (Sunflower) Seed Oil, Theobroma Cacao (Cocoa) Seed Butter, Sucrose, *Oryza Sativa (Rice) Milk, Organic Daucus (Carrots) Carota, Pelargonium Graveolens (Rose Geranium) Essential, and *Pure Essential Oils . *Certified Organic\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cstrong\u003e\u003cspan\u003ePrecaution: \u003c\/span\u003e\u003c\/strong\u003e\u003cspan\u003eFOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab3\"\u003e JACQ's uses fresh carrots in EVERY batch. Carrots are rich in vitamin A, beta-carotene, and antioxidants. These combinations of nutrients, minerals, and vitamins work together to help protect against free radical damage, hyper-pigmentation, acne, and premature wrinkles. Aloe vera is extremely moisturizing, healing and restores suppleness to the skin. We also use fresh aloe in every batch. This cleansing bar contains certified-organic coconut oil that helps create a bubbly soap bar. Acne scars, discoloration, and uneven skin tone can be annoying. Rice Milk used in Asia for centuries works to naturally even skin tone, hydrate, and shrink the appearance of enlarged pores. Combined with the carrots, the rice milk, carotenoids work together to lighten dark spots, seal in moisture and leave skin glowing.\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-11-10T07:07:27-05:00","created_at":"2015-05-26T14:35:43-04:00","vendor":"jacqsorganics","type":"Soap","tags":["ACNE","BLEMISHES","Carrot","carrot con leche","DARK SPOTS","HIBISCUS","HYPERPIGMENTATION","rice milk","soap"],"price":750,"price_min":750,"price_max":1300,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":32313779388464,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Wild Hibiscus \u0026 Carrot Cleansing Bar - 2oz","public_title":"2oz","options":["2oz"],"price":750,"weight":85,"compare_at_price":null,"inventory_quantity":121,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]},{"id":32313779421232,"title":"4oz","option1":"4oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Wild Hibiscus \u0026 Carrot Cleansing Bar - 4oz","public_title":"4oz","options":["4oz"],"price":1300,"weight":85,"compare_at_price":null,"inventory_quantity":180,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscuscarrotsoapbar937x1075.jpg?v=1628544508","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscusandwildcarrotbeautybarfront.jpg?v=1628544508","\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsHibiscusandWildCarrot937x1075.png?v=1657228452","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscusandcarrotbeautybar3_92c3c18f-2a2a-49c0-b921-81b54a791cdd.jpg?v=1657228452","\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsHibiscusandWildCarrot2937x1075.png?v=1657228515"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscuscarrotsoapbar937x1075.jpg?v=1628544508","options":["Size"],"media":[{"alt":null,"id":21058718924848,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscuscarrotsoapbar937x1075.jpg?v=1628544508"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscuscarrotsoapbar937x1075.jpg?v=1628544508","width":937},{"alt":"JACQ's hibiscus \u0026 carrot cleansing bar, pink packaging","id":7562081566768,"position":2,"preview_image":{"aspect_ratio":0.877,"height":1067,"width":936,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscusandwildcarrotbeautybarfront.jpg?v=1628544508"},"aspect_ratio":0.877,"height":1067,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscusandwildcarrotbeautybarfront.jpg?v=1628544508","width":936},{"alt":null,"id":22440177532976,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsHibiscusandWildCarrot937x1075.png?v=1657228452"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsHibiscusandWildCarrot937x1075.png?v=1657228452","width":937},{"alt":"2 JACQ's wild hibiscus \u0026 carrot cleansing bars, pink packaging","id":7562981605424,"position":4,"preview_image":{"aspect_ratio":0.88,"height":1064,"width":936,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscusandcarrotbeautybar3_92c3c18f-2a2a-49c0-b921-81b54a791cdd.jpg?v=1657228452"},"aspect_ratio":0.88,"height":1064,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscusandcarrotbeautybar3_92c3c18f-2a2a-49c0-b921-81b54a791cdd.jpg?v=1657228452","width":936},{"alt":null,"id":22440181563440,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsHibiscusandWildCarrot2937x1075.png?v=1657228515"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsHibiscusandWildCarrot2937x1075.png?v=1657228515","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Certified Organic Moisturizing Rice Milk \u0026amp; Aloe Vera Soap Bar\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT IS IT?\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003eOrganic carrots, organic rice milk, and moisturizing Aloe vera in each and every batch of our carrot con Leche cleansing bars. The results are skin moisturizing, blemish fighting soft bubble producing dirt fighting goodness. Got annoying blemishes on your back and arms? Aging is an issue? Or your skin is really sensitive? Then JACQ's has you covered. Give our organic cleansing bar a try. Did we mention, it won't dry your skin out.  AVAILABLE IN A SMALLER SIZE. \u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eDETAILS:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_small.jpg?v=1499303284\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_small.jpg?v=1499297299\" alt=\"cruelty free, bunny icon\" style=\"float: none;\"\u003e  \u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" alt=\"organic ingredients, leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\" alt=\"handmade small batches, unicorn icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003eWHAT'S IN JACQ's HIBISCUS \u0026amp; CARROT CLEANSING BAR:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003eSaponified oils of Cocos Nucifera (Coconut) Oil, Helianthus Annuus (Sunflower) Seed Oil, Theobroma Cacao (Cocoa) Seed Butter, Sucrose, *Oryza Sativa (Rice) Milk, Organic Daucus (Carrots) Carota, Pelargonium Graveolens (Rose Geranium) Essential, and *Pure Essential Oils . *Certified Organic\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cstrong\u003e\u003cspan\u003ePrecaution: \u003c\/span\u003e\u003c\/strong\u003e\u003cspan\u003eFOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab3\"\u003e JACQ's uses fresh carrots in EVERY batch. Carrots are rich in vitamin A, beta-carotene, and antioxidants. These combinations of nutrients, minerals, and vitamins work together to help protect against free radical damage, hyper-pigmentation, acne, and premature wrinkles. Aloe vera is extremely moisturizing, healing and restores suppleness to the skin. We also use fresh aloe in every batch. This cleansing bar contains certified-organic coconut oil that helps create a bubbly soap bar. Acne scars, discoloration, and uneven skin tone can be annoying. Rice Milk used in Asia for centuries works to naturally even skin tone, hydrate, and shrink the appearance of enlarged pores. Combined with the carrots, the rice milk, carotenoids work together to lighten dark spots, seal in moisture and leave skin glowing.\u003c\/li\u003e\n\u003c\/ul\u003e"}

JACQ's Wild Hibiscus & Carrot Cleansing Bar

$ 7.50
JACQ's Certified Organic Moisturizing Rice Milk & Aloe Vera Soap Bar WHAT IS IT? Organic carrots, organic rice milk, and moisturizing Aloe vera in each and every batch of our carrot con Leche cleansing bars. The results are skin moisturizing, blemish fighting soft bubble producing dirt fighting goodness. Got annoying...
JACQ'S Balancing Face Serum JACQ's calm & repair face serum
{"id":10500458115,"title":"JACQ'S Balancing Face Serum","handle":"balancing-face-serum","description":"\u003ch2\u003eVegan-Friendly Face Serum with vitamin boost\u003c\/h2\u003e\n\u003cp\u003e10 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThe root of a \u003cstrong\u003ecarrot contains 89% water.\u003c\/strong\u003e This magical plant is high in \u003cstrong\u003eBeta-carotene, Minerals and Vitamins A, B, C and E\u003c\/strong\u003e. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result is hydrating and supple skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Carthamus (Safflower) Tinctorius, *Rosa Canina (Rosehip) Seed Fruit Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Falcatum (Bupleurum) Root Extract, *Rumex (Yellow Dock) Crispus Extract, *Gentiana Lutea (Gentian) Root Extract, *Aloe Barbadensis Extract, Glycerin, Hippophae Rhamnoides (Sea Buckthorn Berry) CO2 extract, *Pelargonium (Rose Geranium) Graveolens Oil, *Ocimum Basillicum (Basil) Oil, Panthenol, Pure Essential Oils, Tocopherol (non-GM0) and Ferulic Acid. **Certified Organic Ingredient\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eA little goes a long way. Warm one to two drops between hands then gently press onto damp face, neck and decolletage.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e 20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e\n\u003ch3\u003e\n\u003cstrong\u003eKEY \u003c\/strong\u003e\u003cstrong\u003eINGREDIENTS\u003c\/strong\u003e FOR JACQ'S ORGANIC FACE SERUM\u003c\/h3\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003eCarrot\u003c\/strong\u003e is a natural source of beta-carotene, biotin and lycopene. Great for feeding skin antioxidants, cellular reproduction and improving skin texture.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Geranium\u003c\/strong\u003e is an aromatic, floral and sweet essential oil that's an ideal ingredient that \u003cspan\u003epromotes \u003c\/span\u003e\u003cem\u003eskin\u003c\/em\u003e\u003cspan\u003e cell renewal and ideal ingredient for all skin for every skin type.\u003c\/span\u003e \u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eFerulic Acid\u003c\/strong\u003e is a plant-based antioxidant with a rich source of Vitamin C \u0026amp; E. A beautiful ingredient known to naturally brighten skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRosehip Seed Oil\u003c\/strong\u003e is packed with vitamins, antioxidants and essential fatty acids that help combat uneven skin tone and fine lines. \u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-14T12:13:43-04:00","created_at":"2017-06-09T16:24:14-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["antiaging","beta carotene","carrot","face serum","ferulic acid","minerals","rosehip seed oil","vitamin A","Vitamin B","Vitamin C"],"price":1900,"price_min":1900,"price_max":6200,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636383363,"title":"1oz","option1":"1oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S Balancing Face Serum - 1oz","public_title":"1oz","options":["1oz"],"price":6200,"weight":85,"compare_at_price":null,"inventory_quantity":150,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]},{"id":31932473475120,"title":"5g","option1":"5g","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S Balancing Face Serum - 5g","public_title":"5g","options":["5g"],"price":1900,"weight":10,"compare_at_price":null,"inventory_quantity":282,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum2937x1075.png?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumback.jpg?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs7gbalancingfaceserumfront.jpg?v=1657228018"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018","options":["Size"],"media":[{"alt":null,"id":22440135163952,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018","width":937},{"alt":"JACQ's calm \u0026 repair face serum","id":7561919660080,"position":2,"preview_image":{"aspect_ratio":0.881,"height":1063,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1657228018"},"aspect_ratio":0.881,"height":1063,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1657228018","width":937},{"alt":null,"id":22440140668976,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum2937x1075.png?v=1657228018"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum2937x1075.png?v=1657228018","width":937},{"alt":"JACQ's calm \u0026 repair face serum ingredients label","id":7561919627312,"position":4,"preview_image":{"aspect_ratio":0.873,"height":1070,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumback.jpg?v=1657228018"},"aspect_ratio":0.873,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumback.jpg?v=1657228018","width":934},{"alt":"JACQ's Balancing Face Serum ","id":7561935388720,"position":5,"preview_image":{"aspect_ratio":0.869,"height":1073,"width":932,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs7gbalancingfaceserumfront.jpg?v=1657228018"},"aspect_ratio":0.869,"height":1073,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs7gbalancingfaceserumfront.jpg?v=1657228018","width":932}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eVegan-Friendly Face Serum with vitamin boost\u003c\/h2\u003e\n\u003cp\u003e10 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThe root of a \u003cstrong\u003ecarrot contains 89% water.\u003c\/strong\u003e This magical plant is high in \u003cstrong\u003eBeta-carotene, Minerals and Vitamins A, B, C and E\u003c\/strong\u003e. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result is hydrating and supple skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Carthamus (Safflower) Tinctorius, *Rosa Canina (Rosehip) Seed Fruit Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Falcatum (Bupleurum) Root Extract, *Rumex (Yellow Dock) Crispus Extract, *Gentiana Lutea (Gentian) Root Extract, *Aloe Barbadensis Extract, Glycerin, Hippophae Rhamnoides (Sea Buckthorn Berry) CO2 extract, *Pelargonium (Rose Geranium) Graveolens Oil, *Ocimum Basillicum (Basil) Oil, Panthenol, Pure Essential Oils, Tocopherol (non-GM0) and Ferulic Acid. **Certified Organic Ingredient\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eA little goes a long way. Warm one to two drops between hands then gently press onto damp face, neck and decolletage.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e 20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e\n\u003ch3\u003e\n\u003cstrong\u003eKEY \u003c\/strong\u003e\u003cstrong\u003eINGREDIENTS\u003c\/strong\u003e FOR JACQ'S ORGANIC FACE SERUM\u003c\/h3\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003eCarrot\u003c\/strong\u003e is a natural source of beta-carotene, biotin and lycopene. Great for feeding skin antioxidants, cellular reproduction and improving skin texture.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Geranium\u003c\/strong\u003e is an aromatic, floral and sweet essential oil that's an ideal ingredient that \u003cspan\u003epromotes \u003c\/span\u003e\u003cem\u003eskin\u003c\/em\u003e\u003cspan\u003e cell renewal and ideal ingredient for all skin for every skin type.\u003c\/span\u003e \u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eFerulic Acid\u003c\/strong\u003e is a plant-based antioxidant with a rich source of Vitamin C \u0026amp; E. A beautiful ingredient known to naturally brighten skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRosehip Seed Oil\u003c\/strong\u003e is packed with vitamins, antioxidants and essential fatty acids that help combat uneven skin tone and fine lines. \u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e"}

JACQ'S Balancing Face Serum

$ 19.00
Vegan-Friendly Face Serum with vitamin boost 10 ACTIVE INGREDIENTS PRODUCT INFO INGREDIENTS HOW TO USE The root of a carrot contains 89% water. This magical plant is high in Beta-carotene, Minerals and Vitamins A, B, C and E. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result...
JACQ'S BEAUTY & BATH BAR FOR CLEANSING & EXFOLIATING Black woman holding JACQ's activated charcoal face cleansing bar
{"id":280219680797,"title":"JACQ's Plantain \u0026 Activated Charcoal Face Cleansing Bar","handle":"jacqs-plantain-charcoal-face-cleansing-bar","description":"\u003ch2\u003eUnclog Pores with JACQ's Plantain \u0026amp; Charcoal Face Cleansing Bar for Oily \u0026amp; Acne-Prone Skin\u003c\/h2\u003e\n\u003ch3\u003eWHAT IS IT?\u003c\/h3\u003e\n\u003cdiv\u003e\n\u003cspan\u003ePlantain peel and activated bamboo charcoal are the two main ingredients in this intoxicating cleansing bar to gently scrub away the day. Use it on your face or body, this bar is ideal for clogged pores, oily skin and acne-prone skin. The bamboo charcoal works to absorb oils and toxins from the body. T\u003c\/span\u003ehe combination\u003cspan\u003e of plantain, oils and activated charcoal delivers nutrients, \u003c\/span\u003eminerals\u003cspan\u003e and vitamins that work together to heal and protect skin. \u003c\/span\u003eGot annoying blemishes on your face, back and arms? Then we've got you covered. Give our cleansing bar a try. AVAILABLE IN A SMALLER SIZE. \u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003ch3\u003e\u003cstrong\u003eJACQ'S VEGAN-FRIENDLY PLANTAIN \u0026amp; CHARCOAL FACE CLEANSING BAR DETAILS:\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"ALL SKIN TYPES ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cimg alt=\"VEGAN-FRIENDLY BIRD ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_small.jpg?v=1499303284\" style=\"float: none;\"\u003e\u003cimg alt=\"CRUELTY-FREE BUNNY ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_small.jpg?v=1499297299\" style=\"float: none;\"\u003e  \u003cimg alt=\"ORGANIC INGREDIENTS LEAF ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003cimg alt=\"UNICORN ICON, HANDMADE IN SMALL BATCHES\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003ch3 style=\"text-align: left;\"\u003e\u003cstrong\u003eWHAT'S IN JACQ'S PLANTAIN \u0026amp; ACTIVATED CHARCOAL CLEANSING BAR:\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cdiv style=\"text-align: left;\"\u003eSaponified oils of Cocos Nucifera (Coconut) Oil, Helianthus Annuus (Sunflower) Seed Oil, Theobroma Cacao (Cocoa) Seed Butter, Aloe Barbadensis Leaf Juice, Plantago (Plantain) Peel Powder *Palma Christi (Haitian Castor Oil), *Activated Bamboo Charcoal, *Citrus Medica Limonum (Lemon) Oil, Pinus (Pine Needle) Sylvestris leaf Oil and Pure Essential Oils. *Certified Organic\u003cbr\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cstrong\u003e\u003cspan\u003ePrecaution: \u003c\/span\u003e\u003c\/strong\u003e\u003cspan\u003eFOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cul class=\"tabs-content\"\u003e\u003c\/ul\u003e","published_at":"2017-11-10T07:07:27-05:00","created_at":"2017-11-10T07:24:18-05:00","vendor":"jacqsorganics","type":"Soap","tags":["black soap","charcoal","fancy detox","plantain","soap"],"price":750,"price_min":750,"price_max":1400,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4029986766877,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":1748337131549,"product_id":280219680797,"position":4,"created_at":"2018-02-22T10:28:06-05:00","updated_at":"2020-07-21T09:55:12-04:00","alt":"JACQ's Skincare - organic face cleansing bars x 4","width":1280,"height":1920,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/pumpkin_and_charcoal_cleansing_soap_jacqs.jpg?v=1595339712","variant_ids":[4029986766877]},"available":true,"name":"JACQ's Plantain \u0026 Activated Charcoal Face Cleansing Bar - 2oz","public_title":"2oz","options":["2oz"],"price":750,"weight":85,"compare_at_price":null,"inventory_quantity":155,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":"JACQ's Skincare - organic face cleansing bars x 4","id":812127715376,"position":4,"preview_image":{"aspect_ratio":0.667,"height":1920,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/pumpkin_and_charcoal_cleansing_soap_jacqs.jpg?v=1595339712"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":4029986799645,"title":"4oz","option1":"4oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Plantain \u0026 Activated Charcoal Face Cleansing Bar - 4oz","public_title":"4oz","options":["4oz"],"price":1400,"weight":85,"compare_at_price":null,"inventory_quantity":101,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoap.jpg?v=1596329025","\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_soap_bar_jacqs.jpg?v=1595339712","\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqs_PlantainCharcoal_Soap_Render3.jpg?v=1596329052","\/\/\/s\/files\/1\/0877\/4074\/products\/pumpkin_and_charcoal_cleansing_soap_jacqs.jpg?v=1595339712","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoapback.jpg?v=1596329041"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoap.jpg?v=1596329025","options":["Size"],"media":[{"alt":"JACQ'S BEAUTY \u0026 BATH BAR FOR CLEANSING \u0026 EXFOLIATING","id":7584497696816,"position":1,"preview_image":{"aspect_ratio":0.875,"height":1068,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoap.jpg?v=1596329025"},"aspect_ratio":0.875,"height":1068,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoap.jpg?v=1596329025","width":934},{"alt":"Black woman holding JACQ's activated charcoal face cleansing bar","id":812127977520,"position":2,"preview_image":{"aspect_ratio":0.825,"height":1552,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_soap_bar_jacqs.jpg?v=1595339712"},"aspect_ratio":0.825,"height":1552,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_soap_bar_jacqs.jpg?v=1595339712","width":1280},{"alt":"JACQ'S BEAUTY BAR PACKAGING, FRONT","id":7584433700912,"position":3,"preview_image":{"aspect_ratio":1.408,"height":2300,"width":3238,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqs_PlantainCharcoal_Soap_Render3.jpg?v=1596329052"},"aspect_ratio":1.408,"height":2300,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqs_PlantainCharcoal_Soap_Render3.jpg?v=1596329052","width":3238},{"alt":"JACQ's Skincare - organic face cleansing bars x 4","id":812127715376,"position":4,"preview_image":{"aspect_ratio":0.667,"height":1920,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/pumpkin_and_charcoal_cleansing_soap_jacqs.jpg?v=1595339712"},"aspect_ratio":0.667,"height":1920,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/pumpkin_and_charcoal_cleansing_soap_jacqs.jpg?v=1595339712","width":1280},{"alt":"JACQ'S BEAUTY BAR PACKAGING, PINK","id":7562146873392,"position":5,"preview_image":{"aspect_ratio":0.871,"height":1072,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoapback.jpg?v=1596329041"},"aspect_ratio":0.871,"height":1072,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoapback.jpg?v=1596329041","width":934}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eUnclog Pores with JACQ's Plantain \u0026amp; Charcoal Face Cleansing Bar for Oily \u0026amp; Acne-Prone Skin\u003c\/h2\u003e\n\u003ch3\u003eWHAT IS IT?\u003c\/h3\u003e\n\u003cdiv\u003e\n\u003cspan\u003ePlantain peel and activated bamboo charcoal are the two main ingredients in this intoxicating cleansing bar to gently scrub away the day. Use it on your face or body, this bar is ideal for clogged pores, oily skin and acne-prone skin. The bamboo charcoal works to absorb oils and toxins from the body. T\u003c\/span\u003ehe combination\u003cspan\u003e of plantain, oils and activated charcoal delivers nutrients, \u003c\/span\u003eminerals\u003cspan\u003e and vitamins that work together to heal and protect skin. \u003c\/span\u003eGot annoying blemishes on your face, back and arms? Then we've got you covered. Give our cleansing bar a try. AVAILABLE IN A SMALLER SIZE. \u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003ch3\u003e\u003cstrong\u003eJACQ'S VEGAN-FRIENDLY PLANTAIN \u0026amp; CHARCOAL FACE CLEANSING BAR DETAILS:\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"ALL SKIN TYPES ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cimg alt=\"VEGAN-FRIENDLY BIRD ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_small.jpg?v=1499303284\" style=\"float: none;\"\u003e\u003cimg alt=\"CRUELTY-FREE BUNNY ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_small.jpg?v=1499297299\" style=\"float: none;\"\u003e  \u003cimg alt=\"ORGANIC INGREDIENTS LEAF ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003cimg alt=\"UNICORN ICON, HANDMADE IN SMALL BATCHES\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003ch3 style=\"text-align: left;\"\u003e\u003cstrong\u003eWHAT'S IN JACQ'S PLANTAIN \u0026amp; ACTIVATED CHARCOAL CLEANSING BAR:\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cdiv style=\"text-align: left;\"\u003eSaponified oils of Cocos Nucifera (Coconut) Oil, Helianthus Annuus (Sunflower) Seed Oil, Theobroma Cacao (Cocoa) Seed Butter, Aloe Barbadensis Leaf Juice, Plantago (Plantain) Peel Powder *Palma Christi (Haitian Castor Oil), *Activated Bamboo Charcoal, *Citrus Medica Limonum (Lemon) Oil, Pinus (Pine Needle) Sylvestris leaf Oil and Pure Essential Oils. *Certified Organic\u003cbr\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cstrong\u003e\u003cspan\u003ePrecaution: \u003c\/span\u003e\u003c\/strong\u003e\u003cspan\u003eFOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cul class=\"tabs-content\"\u003e\u003c\/ul\u003e"}

JACQ's Plantain & Activated Charcoal Face Cleansing Bar

$ 7.50
Unclog Pores with JACQ's Plantain & Charcoal Face Cleansing Bar for Oily & Acne-Prone Skin WHAT IS IT? Plantain peel and activated bamboo charcoal are the two main ingredients in this intoxicating cleansing bar to gently scrub away the day. Use it on your face or body, this bar is...
JACQ's Clarifying Green Smoothie Face Masque and Scrub JACQ's Clarifying Green Smoothie Face Masque and Scrub
{"id":10500475139,"title":"JACQ's Clarifying Green Smoothie Face Masque and Scrub","handle":"jacqs-clarifying-green-smoothie-face-mask-scrub","description":"\u003ch2\u003eJACQ's Green Smoothie Organic Face Mask \u0026amp; Scrub with Charcoal and Sea Salt\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eIt's all about the face mask. JACQ's Green Smoothie Face Masque and Scrub aka Clarifying Mask contains an abundance of Minerals, Botanical Peptides and Rich Clays that work to help get oxygen into skin cells. Our blend of Montmorillonite Clay, Activated Charcoal, and Dead Sea Salt paired together with olive-derived Squalane to draw out impurities while nourishing the skin. Protective Vitamin B3, the natural fruit acids extracts, and our proprietary essential oil blend leaves your skin feeling refreshed, cool and clean.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Rhassoul Clay (Moroccan Lava Clay), *Bentonite Clay, *Zea Mays (Corn) Starch, *Bamboo Activated Charcoal Powder, *Tapioca Starch, *Ascophyllum (Kelp Powder) Nodosum Powder, Calophyllum Inophyllum (Tamanu) Oil. Sodium Chloride (Dead Sea Salt), Niacinamide, Spearmint Oil, Lavender Oil, Rosmarinus Officinalis (Rosemary) Oil, Citrus Limonium (Lemon) Oil, Galangal Extract and Pure Essential Oils. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e45ML - Mix 1\/4 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation. 20ML - Mix 1\/8 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e30 ACTIVE INGREDIENTS IN JACQ'S GREEN SMOOTHIE ORGANIC FACE MASQUE \u0026amp; SCRUB\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e \u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"organic leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\" alt=\"oily\/combination skin, globe icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e","published_at":"2017-07-14T12:13:43-04:00","created_at":"2017-06-09T16:31:39-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["charcoal","essential oils","exfoliate","face scrub","green smoothie face mask","lavender","lemon","Moroccan","organic"],"price":1700,"price_min":1700,"price_max":2700,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636537923,"title":"2 oz","option1":"2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":30101985886256,"product_id":10500475139,"position":1,"created_at":"2022-07-07T16:01:43-04:00","updated_at":"2022-07-07T16:01:49-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","variant_ids":[40636537923]},"available":true,"name":"JACQ's Clarifying Green Smoothie Face Masque and Scrub - 2 oz","public_title":"2 oz","options":["2 oz"],"price":2700,"weight":71,"compare_at_price":null,"inventory_quantity":77,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":22439797260336,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":41905034243,"title":"45 ml","option1":"45 ml","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":30101999845424,"product_id":10500475139,"position":5,"created_at":"2022-07-07T16:05:04-04:00","updated_at":"2022-07-07T16:05:04-04:00","alt":null,"width":935,"height":1070,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304","variant_ids":[41905034243]},"available":true,"name":"JACQ's Clarifying Green Smoothie Face Masque and Scrub - 45 ml","public_title":"45 ml","options":["45 ml"],"price":1700,"weight":168,"compare_at_price":null,"inventory_quantity":129,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":22439813480496,"position":5,"preview_image":{"aspect_ratio":0.874,"height":1070,"width":935,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASKFRONT_9a207218-6f87-441f-a19a-3518ae6259bf.jpg?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask_1.png?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_face_mask_caasi1024X1024.jpg?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","options":["Size"],"media":[{"alt":null,"id":22439797260336,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","width":937},{"alt":null,"id":7584607666224,"position":2,"preview_image":{"aspect_ratio":0.874,"height":1067,"width":933,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASKFRONT_9a207218-6f87-441f-a19a-3518ae6259bf.jpg?v=1657224109"},"aspect_ratio":0.874,"height":1067,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASKFRONT_9a207218-6f87-441f-a19a-3518ae6259bf.jpg?v=1657224109","width":933},{"alt":null,"id":7584659111984,"position":3,"preview_image":{"aspect_ratio":0.874,"height":435,"width":380,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask_1.png?v=1657224109"},"aspect_ratio":0.874,"height":435,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask_1.png?v=1657224109","width":380},{"alt":"Black woman wearing JACQ's green smoothie face mask, drinking tea","id":435672875056,"position":4,"preview_image":{"aspect_ratio":1.0,"height":1024,"width":1024,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_face_mask_caasi1024X1024.jpg?v=1657224109"},"aspect_ratio":1.0,"height":1024,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_face_mask_caasi1024X1024.jpg?v=1657224109","width":1024},{"alt":null,"id":22439813480496,"position":5,"preview_image":{"aspect_ratio":0.874,"height":1070,"width":935,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304"},"aspect_ratio":0.874,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304","width":935}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Green Smoothie Organic Face Mask \u0026amp; Scrub with Charcoal and Sea Salt\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eIt's all about the face mask. JACQ's Green Smoothie Face Masque and Scrub aka Clarifying Mask contains an abundance of Minerals, Botanical Peptides and Rich Clays that work to help get oxygen into skin cells. Our blend of Montmorillonite Clay, Activated Charcoal, and Dead Sea Salt paired together with olive-derived Squalane to draw out impurities while nourishing the skin. Protective Vitamin B3, the natural fruit acids extracts, and our proprietary essential oil blend leaves your skin feeling refreshed, cool and clean.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Rhassoul Clay (Moroccan Lava Clay), *Bentonite Clay, *Zea Mays (Corn) Starch, *Bamboo Activated Charcoal Powder, *Tapioca Starch, *Ascophyllum (Kelp Powder) Nodosum Powder, Calophyllum Inophyllum (Tamanu) Oil. Sodium Chloride (Dead Sea Salt), Niacinamide, Spearmint Oil, Lavender Oil, Rosmarinus Officinalis (Rosemary) Oil, Citrus Limonium (Lemon) Oil, Galangal Extract and Pure Essential Oils. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e45ML - Mix 1\/4 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation. 20ML - Mix 1\/8 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e30 ACTIVE INGREDIENTS IN JACQ'S GREEN SMOOTHIE ORGANIC FACE MASQUE \u0026amp; SCRUB\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e \u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"organic leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\" alt=\"oily\/combination skin, globe icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e"}

JACQ's Clarifying Green Smoothie Face Masque and Scrub

$ 17.00
JACQ's Green Smoothie Organic Face Mask & Scrub with Charcoal and Sea Salt PRODUCT INFO INGREDIENTS HOW TO USE It's all about the face mask. JACQ's Green Smoothie Face Masque and Scrub aka Clarifying Mask contains an abundance of Minerals, Botanical Peptides and Rich Clays that work to help get oxygen into skin cells. Our...
JACQ's Yucca & Lavender Cleansing Bar JACQ's Yucca & Lavendar Cleansing Soap Bar, Pink packaging
{"id":280287215645,"title":"JACQ's Yucca \u0026 Lavender Cleansing Bar","handle":"yucca-lavender-cleansing-bar","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Certified Organic Cleansing Soap Bar for Sensitive Skin\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT IS IT?\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan\u003eThis rich creamy bar is made for individuals with sensitive skin. Rich in antioxidants, vitamins A, B and C Yucca is a cell regenerating ingredient that serves as the main ingredient in this soap bar. This skin conditioning root combined with healing Lavender essential oil works to gently soothe and promote the growth of younger cells. \u003c\/span\u003e AVAILABLE IN A SMALLER SIZE. \u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eDETAILS:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink hand icon\"\u003e\u003cimg style=\"float: none;\" alt=\"vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_small.jpg?v=1499303284\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, bunny icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_small.jpg?v=1499297299\"\u003e  \u003cimg style=\"float: none;\" alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\"\u003e\u003cimg style=\"float: none;\" alt=\"handmade small batches, unicorn icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\"\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003eWHAT'S IN JACQ's YUCCA \u0026amp; LAVENDAR CLEANSING BAR:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cspan\u003eSaponified oils of Cocos Nucifera (Coconut) Oil, Helianthus Annuus (Sunflower) Seed Oil, Theobroma Cacao (Cocoa) Seed Butter, Sucrose, Pureed Yucca Schidigera, Lavandula (Lavender) Angustifolia Officinalis and Pure Essential Oils. *Certified Organic\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cstrong\u003e\u003cspan\u003ePrecaution: \u003c\/span\u003e\u003c\/strong\u003e\u003cspan\u003eFOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cul class=\"tabs-content\"\u003e\u003c\/ul\u003e","published_at":"2017-11-10T07:07:27-05:00","created_at":"2017-11-10T08:16:36-05:00","vendor":"jacqsorganics","type":"Soap","tags":["antioxidants","creamy cocoa butter soap","eczema","lavender","sensitive skin","soap","vitamin A","Vitamin B","vitamin C","yucca"],"price":750,"price_min":750,"price_max":1300,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4030572724253,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":1748345356317,"product_id":280287215645,"position":3,"created_at":"2018-02-22T10:31:29-05:00","updated_at":"2021-08-09T17:30:27-04:00","alt":"3 JACQ's organic soap bars stacked","width":1280,"height":1920,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_yucca_and_lavender_1.jpg?v=1628544627","variant_ids":[4030572724253]},"available":true,"name":"JACQ's Yucca \u0026 Lavender Cleansing Bar - 2oz","public_title":"2oz","options":["2oz"],"price":750,"weight":85,"compare_at_price":null,"inventory_quantity":93,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":"3 JACQ's organic soap bars stacked","id":812127780912,"position":3,"preview_image":{"aspect_ratio":0.667,"height":1920,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_yucca_and_lavender_1.jpg?v=1628544627"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":4030572757021,"title":"4oz","option1":"4oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15388728197168,"product_id":280287215645,"position":2,"created_at":"2020-07-16T07:59:22-04:00","updated_at":"2021-08-09T17:30:27-04:00","alt":"JACQ's Yucca \u0026 Lavendar Cleansing Soap Bar, Pink packaging","width":937,"height":1066,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandyuccasoapbarback.jpg?v=1628544627","variant_ids":[4030572757021]},"available":true,"name":"JACQ's Yucca \u0026 Lavender Cleansing Bar - 4oz","public_title":"4oz","options":["4oz"],"price":1300,"weight":85,"compare_at_price":null,"inventory_quantity":113,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":"JACQ's Yucca \u0026 Lavendar Cleansing Soap Bar, Pink packaging","id":7562122559536,"position":2,"preview_image":{"aspect_ratio":0.879,"height":1066,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandyuccasoapbarback.jpg?v=1628544627"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsyuccalavendersoapbar937x1075.jpg?v=1628544627","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandyuccasoapbarback.jpg?v=1628544627","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_yucca_and_lavender_1.jpg?v=1628544627","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsyuccabeautybar3.jpg?v=1628544627","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandyuccasoapbar.jpg?v=1628544627","\/\/\/s\/files\/1\/0877\/4074\/products\/2_yucca_and_lavender_jacqs_organics.jpg?v=1628544627"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsyuccalavendersoapbar937x1075.jpg?v=1628544627","options":["Size"],"media":[{"alt":null,"id":21058723381296,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsyuccalavendersoapbar937x1075.jpg?v=1628544627"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsyuccalavendersoapbar937x1075.jpg?v=1628544627","width":937},{"alt":"JACQ's Yucca \u0026 Lavendar Cleansing Soap Bar, Pink packaging","id":7562122559536,"position":2,"preview_image":{"aspect_ratio":0.879,"height":1066,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandyuccasoapbarback.jpg?v=1628544627"},"aspect_ratio":0.879,"height":1066,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandyuccasoapbarback.jpg?v=1628544627","width":937},{"alt":"3 JACQ's organic soap bars stacked","id":812127780912,"position":3,"preview_image":{"aspect_ratio":0.667,"height":1920,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_yucca_and_lavender_1.jpg?v=1628544627"},"aspect_ratio":0.667,"height":1920,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_yucca_and_lavender_1.jpg?v=1628544627","width":1280},{"alt":"2 JACQ's organic cleansing soap bars, pink packaging","id":7562991894576,"position":4,"preview_image":{"aspect_ratio":0.878,"height":1067,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsyuccabeautybar3.jpg?v=1628544627"},"aspect_ratio":0.878,"height":1067,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsyuccabeautybar3.jpg?v=1628544627","width":937},{"alt":"JACQ's label packaging, made in USA soap bars, pink packaging","id":7562122592304,"position":5,"preview_image":{"aspect_ratio":0.878,"height":1061,"width":932,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandyuccasoapbar.jpg?v=1628544627"},"aspect_ratio":0.878,"height":1061,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandyuccasoapbar.jpg?v=1628544627","width":932},{"alt":"JACQ's Yucca \u0026 Lavender Cleansing bar in ar ow","id":1015855480880,"position":6,"preview_image":{"aspect_ratio":0.746,"height":1716,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/2_yucca_and_lavender_jacqs_organics.jpg?v=1628544627"},"aspect_ratio":0.746,"height":1716,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/2_yucca_and_lavender_jacqs_organics.jpg?v=1628544627","width":1280}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Certified Organic Cleansing Soap Bar for Sensitive Skin\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT IS IT?\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan\u003eThis rich creamy bar is made for individuals with sensitive skin. Rich in antioxidants, vitamins A, B and C Yucca is a cell regenerating ingredient that serves as the main ingredient in this soap bar. This skin conditioning root combined with healing Lavender essential oil works to gently soothe and promote the growth of younger cells. \u003c\/span\u003e AVAILABLE IN A SMALLER SIZE. \u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eDETAILS:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink hand icon\"\u003e\u003cimg style=\"float: none;\" alt=\"vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_small.jpg?v=1499303284\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, bunny icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_small.jpg?v=1499297299\"\u003e  \u003cimg style=\"float: none;\" alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\"\u003e\u003cimg style=\"float: none;\" alt=\"handmade small batches, unicorn icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\"\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003eWHAT'S IN JACQ's YUCCA \u0026amp; LAVENDAR CLEANSING BAR:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cspan\u003eSaponified oils of Cocos Nucifera (Coconut) Oil, Helianthus Annuus (Sunflower) Seed Oil, Theobroma Cacao (Cocoa) Seed Butter, Sucrose, Pureed Yucca Schidigera, Lavandula (Lavender) Angustifolia Officinalis and Pure Essential Oils. *Certified Organic\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cstrong\u003e\u003cspan\u003ePrecaution: \u003c\/span\u003e\u003c\/strong\u003e\u003cspan\u003eFOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cul class=\"tabs-content\"\u003e\u003c\/ul\u003e"}

JACQ's Yucca & Lavender Cleansing Bar

$ 7.50
JACQ's Certified Organic Cleansing Soap Bar for Sensitive Skin WHAT IS IT? This rich creamy bar is made for individuals with sensitive skin. Rich in antioxidants, vitamins A, B and C Yucca is a cell regenerating ingredient that serves as the main ingredient in this soap bar. This skin conditioning...
JACQ's pink beauty & bath bar packaging x 3 Black woman holding 2 JACQ's beauty bars, charcoal, and beige
{"id":440322588701,"title":"JACQ's Exfoliating Beauty Bar Trio","handle":"beauty-bar-trio","description":"\u003ch2\u003eCleanse, Exfoliate, and Detoxify with JACQ'S Beauty Bar Set\u003c\/h2\u003e\n\u003cp\u003eWho said the only way to detox is by drinking a smoothie, detoxing, or sipping on tea? Here's the perfect way to cleanse, exfoliate, and detox your skin from the outside in. With JACQ's Beauty Bar Set, each bar formulated to help remove dirt, grime, and oils from your skin. The collections come with:\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e\u003cspan\u003e1- 2oz Plantain \u0026amp; Charcoal Beauty Bar\u003c\/span\u003e\u003c\/li\u003e\n\u003cli\u003e\u003cspan\u003e\u003cspan\u003e1- 2oz Hibiscus \u0026amp; Wild Carrot Beauty Bar\u003c\/span\u003e\u003c\/span\u003e\u003c\/li\u003e\n\u003cli\u003e\u003cspan\u003e\u003cspan\u003e1- 2oz Lavender \u0026amp; Yucca Beauty Bar\u003c\/span\u003e\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan\u003e\u003cspan\u003e*Pick any variation of the soap bars. Leave a comment at checkout explaining which bars you'd like to include in your order.\u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eHow to Use JACQ's Beauty Bars:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eSee individual product pages for instructions.\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_31a31d7b-01a1-4771-944c-1f6f542a5ac3_compact.jpg?v=1519958948\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"organic ingredients, plant icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\n\u003c\/div\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eShips in 1-2 business days.\u003c\/p\u003e","published_at":"2018-03-13T11:07:54-04:00","created_at":"2018-03-13T10:52:38-04:00","vendor":"Jacq's","type":"Gifts","tags":["beauty bar","bundle","carrot","charcoal","gift set","hibiscus","lavender","plantain","yucca"],"price":1750,"price_min":1750,"price_max":3800,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":5927684997149,"title":"4oz Beauty Bars","option1":"4oz Beauty Bars","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15388810281008,"product_id":440322588701,"position":1,"created_at":"2020-07-16T08:20:06-04:00","updated_at":"2021-09-23T12:53:34-04:00","alt":"JACQ's pink beauty \u0026 bath bar packaging x 3","width":934,"height":1002,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014","variant_ids":[5927684997149]},"available":true,"name":"JACQ's Exfoliating Beauty Bar Trio - 4oz Beauty Bars","public_title":"4oz Beauty Bars","options":["4oz Beauty Bars"],"price":3800,"weight":170,"compare_at_price":null,"inventory_quantity":195,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":"JACQ's pink beauty \u0026 bath bar packaging x 3","id":7562204774448,"position":1,"preview_image":{"aspect_ratio":0.932,"height":1002,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":32324163436592,"title":"2oz Beauty Bars","option1":"2oz Beauty Bars","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":1836903301149,"product_id":440322588701,"position":4,"created_at":"2018-03-20T15:41:27-04:00","updated_at":"2021-09-23T12:53:34-04:00","alt":"stack of JACQ's organic beauty bars","width":1280,"height":1920,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_charcoal_soap3.jpg?v=1632416014","variant_ids":[32324163436592]},"available":true,"name":"JACQ's Exfoliating Beauty Bar Trio - 2oz Beauty Bars","public_title":"2oz Beauty Bars","options":["2oz Beauty Bars"],"price":1750,"weight":170,"compare_at_price":null,"inventory_quantity":260,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":"stack of JACQ's organic beauty bars","id":813445283888,"position":4,"preview_image":{"aspect_ratio":0.667,"height":1920,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_charcoal_soap3.jpg?v=1632416014"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_organics_soap_bundle_2018.jpg?v=1632416014","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit1.png?v=1632416003","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_charcoal_soap3.jpg?v=1632416014"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014","options":["Beauty Bars Trio"],"media":[{"alt":"JACQ's pink beauty \u0026 bath bar packaging x 3","id":7562204774448,"position":1,"preview_image":{"aspect_ratio":0.932,"height":1002,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014"},"aspect_ratio":0.932,"height":1002,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoaptrio.jpg?v=1632416014","width":934},{"alt":"Black woman holding 2 JACQ's beauty bars, charcoal, and beige","id":1015855448112,"position":2,"preview_image":{"aspect_ratio":0.768,"height":1666,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_organics_soap_bundle_2018.jpg?v=1632416014"},"aspect_ratio":0.768,"height":1666,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_organics_soap_bundle_2018.jpg?v=1632416014","width":1280},{"alt":null,"id":21180004237360,"position":3,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit1.png?v=1632416003"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit1.png?v=1632416003","width":2048},{"alt":"stack of JACQ's organic beauty bars","id":813445283888,"position":4,"preview_image":{"aspect_ratio":0.667,"height":1920,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_charcoal_soap3.jpg?v=1632416014"},"aspect_ratio":0.667,"height":1920,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_charcoal_soap3.jpg?v=1632416014","width":1280}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eCleanse, Exfoliate, and Detoxify with JACQ'S Beauty Bar Set\u003c\/h2\u003e\n\u003cp\u003eWho said the only way to detox is by drinking a smoothie, detoxing, or sipping on tea? Here's the perfect way to cleanse, exfoliate, and detox your skin from the outside in. With JACQ's Beauty Bar Set, each bar formulated to help remove dirt, grime, and oils from your skin. The collections come with:\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e\u003cspan\u003e1- 2oz Plantain \u0026amp; Charcoal Beauty Bar\u003c\/span\u003e\u003c\/li\u003e\n\u003cli\u003e\u003cspan\u003e\u003cspan\u003e1- 2oz Hibiscus \u0026amp; Wild Carrot Beauty Bar\u003c\/span\u003e\u003c\/span\u003e\u003c\/li\u003e\n\u003cli\u003e\u003cspan\u003e\u003cspan\u003e1- 2oz Lavender \u0026amp; Yucca Beauty Bar\u003c\/span\u003e\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan\u003e\u003cspan\u003e*Pick any variation of the soap bars. Leave a comment at checkout explaining which bars you'd like to include in your order.\u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eHow to Use JACQ's Beauty Bars:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eSee individual product pages for instructions.\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_31a31d7b-01a1-4771-944c-1f6f542a5ac3_compact.jpg?v=1519958948\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"organic ingredients, plant icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\n\u003c\/div\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eShips in 1-2 business days.\u003c\/p\u003e"}

JACQ's Exfoliating Beauty Bar Trio

$ 17.50
Cleanse, Exfoliate, and Detoxify with JACQ'S Beauty Bar Set Who said the only way to detox is by drinking a smoothie, detoxing, or sipping on tea? Here's the perfect way to cleanse, exfoliate, and detox your skin from the outside in. With JACQ's Beauty Bar Set, each bar formulated to help remove...
Showing items 1 - 7 of 7
We use cookies to improve our website and your shopping experience.By continuing to browse our site, you are consenting to our use of cookies. Read more about our Privacy Policy