12 items
New Arrivals
Picked just for you.
Start shopping now.
JACQ's Beta-Acid Acne Treatment JACQ's Beta-Acid Acne Treatment
{"id":10500476675,"title":"JACQ's Beta-Acid Acne Treatment","handle":"the-high-priestess-beauty-booster","description":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-06-09T16:32:27-04:00","vendor":"JACQ'S","type":"Skin Care","tags":[],"price":1900,"price_min":1900,"price_max":1900,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636551619,"title":"1\/2 oz","option1":"1\/2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793009504304,"product_id":10500476675,"position":3,"created_at":"2021-08-09T15:23:56-04:00","updated_at":"2021-08-09T15:49:07-04:00","alt":null,"width":934,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","variant_ids":[40636551619]},"available":true,"name":"JACQ's Beta-Acid Acne Treatment - 1\/2 oz","public_title":"1\/2 oz","options":["1\/2 oz"],"price":1900,"weight":5,"compare_at_price":null,"inventory_quantity":129,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","options":["Size"],"media":[{"alt":null,"id":21058558591024,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058521497648,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"},"aspect_ratio":0.869,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","width":934},{"alt":null,"id":21058521464880,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e"}
{"id":10500480579,"title":"JACQ's PROBIOTIC FACE MASK","handle":"probiotic-face-mask-1","description":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:34-04:00","created_at":"2017-06-09T16:34:13-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","antioxidant","booster","Carrot","emollient","essential oils","Face Mask","face oil","face serum","jackfruit","moisturizer","papaya","protein","skin serum","vitamin E","yucca"],"price":2300,"price_min":2300,"price_max":2300,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636604483,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":29235789692976,"product_id":10500480579,"position":2,"created_at":"2021-12-15T14:18:06-05:00","updated_at":"2022-07-07T16:10:34-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","variant_ids":[40636604483]},"available":true,"name":"JACQ's PROBIOTIC FACE MASK - 2oz","public_title":"2oz","options":["2oz"],"price":2300,"weight":85,"compare_at_price":null,"inventory_quantity":138,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21516283084848,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","options":["Size"],"media":[{"alt":null,"id":22439844610096,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","width":937},{"alt":null,"id":21516283084848,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","width":937},{"alt":null,"id":21058609020976,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634","width":937},{"alt":null,"id":21058585428016,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634","width":937},{"alt":null,"id":21058608988208,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634","width":937},{"alt":null,"id":22439843332144,"position":6,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's Drip Collection Skincare Bundle - Save $10
{"id":10612520899,"title":"JACQ's Drip Collection Skincare Bundle - Save $10","handle":"beauty-boosting-trio","description":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-11T19:04:44-04:00","created_at":"2017-07-09T17:02:19-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","beauty booster","booster","chamomile","face oil","face serum","moringa","protein","protein booster","skin serum","yucca"],"price":6500,"price_min":6500,"price_max":6500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42098492355,"title":"1","option1":"1","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793140805680,"product_id":10612520899,"position":1,"created_at":"2021-08-09T16:36:51-04:00","updated_at":"2021-08-09T16:39:03-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","variant_ids":[42098492355]},"available":true,"name":"JACQ's Drip Collection Skincare Bundle - Save $10 - 1","public_title":"1","options":["1"],"price":6500,"weight":5,"compare_at_price":null,"inventory_quantity":244,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","options":["1 Pack"],"media":[{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's Restorative Face Serum JACQ's Restorative Face Serum
{"id":10636301379,"title":"JACQ's Restorative Face Serum","handle":"jacqs-restorative-face-serum","description":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-07-14T13:01:45-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["amino acids","booster","chamomile","hibiscus","Moringa","plant nutrients","Vitamin A","Vitamin D"],"price":2400,"price_min":2400,"price_max":2400,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42338644867,"title":"1oz","option1":"1oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793074614320,"product_id":10636301379,"position":1,"created_at":"2021-08-09T16:11:09-04:00","updated_at":"2021-08-09T17:44:38-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","variant_ids":[42338644867]},"available":true,"name":"JACQ's Restorative Face Serum - 1oz","public_title":"1oz","options":["1oz"],"price":2400,"weight":5,"compare_at_price":null,"inventory_quantity":33,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","options":["Size"],"media":[{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","width":937},{"alt":null,"id":21058578481200,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","width":937},{"alt":null,"id":21058578513968,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","width":937},{"alt":null,"id":21058578546736,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e"}
JACQ'S BEAUTY & BATH BAR FOR CLEANSING & EXFOLIATING Black woman holding JACQ's activated charcoal face cleansing bar
{"id":280219680797,"title":"JACQ's Plantain \u0026 Activated Charcoal Face Cleansing Bar","handle":"jacqs-plantain-charcoal-face-cleansing-bar","description":"\u003ch2\u003eUnclog Pores with JACQ's Plantain \u0026amp; Charcoal Face Cleansing Bar for Oily \u0026amp; Acne-Prone Skin\u003c\/h2\u003e\n\u003ch3\u003eWHAT IS IT?\u003c\/h3\u003e\n\u003cdiv\u003e\n\u003cspan\u003ePlantain peel and activated bamboo charcoal are the two main ingredients in this intoxicating cleansing bar to gently scrub away the day. Use it on your face or body, this bar is ideal for clogged pores, oily skin and acne-prone skin. The bamboo charcoal works to absorb oils and toxins from the body. T\u003c\/span\u003ehe combination\u003cspan\u003e of plantain, oils and activated charcoal delivers nutrients, \u003c\/span\u003eminerals\u003cspan\u003e and vitamins that work together to heal and protect skin. \u003c\/span\u003eGot annoying blemishes on your face, back and arms? Then we've got you covered. Give our cleansing bar a try. AVAILABLE IN A SMALLER SIZE. \u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003ch3\u003e\u003cstrong\u003eJACQ'S VEGAN-FRIENDLY PLANTAIN \u0026amp; CHARCOAL FACE CLEANSING BAR DETAILS:\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"ALL SKIN TYPES ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cimg alt=\"VEGAN-FRIENDLY BIRD ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_small.jpg?v=1499303284\" style=\"float: none;\"\u003e\u003cimg alt=\"CRUELTY-FREE BUNNY ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_small.jpg?v=1499297299\" style=\"float: none;\"\u003e  \u003cimg alt=\"ORGANIC INGREDIENTS LEAF ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003cimg alt=\"UNICORN ICON, HANDMADE IN SMALL BATCHES\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003ch3 style=\"text-align: left;\"\u003e\u003cstrong\u003eWHAT'S IN JACQ'S PLANTAIN \u0026amp; ACTIVATED CHARCOAL CLEANSING BAR:\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cdiv style=\"text-align: left;\"\u003eSaponified oils of Cocos Nucifera (Coconut) Oil, Helianthus Annuus (Sunflower) Seed Oil, Theobroma Cacao (Cocoa) Seed Butter, Aloe Barbadensis Leaf Juice, Plantago (Plantain) Peel Powder *Palma Christi (Haitian Castor Oil), *Activated Bamboo Charcoal, *Citrus Medica Limonum (Lemon) Oil, Pinus (Pine Needle) Sylvestris leaf Oil and Pure Essential Oils. *Certified Organic\u003cbr\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cstrong\u003e\u003cspan\u003ePrecaution: \u003c\/span\u003e\u003c\/strong\u003e\u003cspan\u003eFOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cul class=\"tabs-content\"\u003e\u003c\/ul\u003e","published_at":"2017-11-10T07:07:27-05:00","created_at":"2017-11-10T07:24:18-05:00","vendor":"jacqsorganics","type":"Soap","tags":["black soap","charcoal","fancy detox","plantain","soap"],"price":750,"price_min":750,"price_max":1400,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4029986766877,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":1748337131549,"product_id":280219680797,"position":4,"created_at":"2018-02-22T10:28:06-05:00","updated_at":"2020-07-21T09:55:12-04:00","alt":"JACQ's Skincare - organic face cleansing bars x 4","width":1280,"height":1920,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/pumpkin_and_charcoal_cleansing_soap_jacqs.jpg?v=1595339712","variant_ids":[4029986766877]},"available":true,"name":"JACQ's Plantain \u0026 Activated Charcoal Face Cleansing Bar - 2oz","public_title":"2oz","options":["2oz"],"price":750,"weight":85,"compare_at_price":null,"inventory_quantity":153,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":"JACQ's Skincare - organic face cleansing bars x 4","id":812127715376,"position":4,"preview_image":{"aspect_ratio":0.667,"height":1920,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/pumpkin_and_charcoal_cleansing_soap_jacqs.jpg?v=1595339712"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":4029986799645,"title":"4oz","option1":"4oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Plantain \u0026 Activated Charcoal Face Cleansing Bar - 4oz","public_title":"4oz","options":["4oz"],"price":1400,"weight":85,"compare_at_price":null,"inventory_quantity":99,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoap.jpg?v=1596329025","\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_soap_bar_jacqs.jpg?v=1595339712","\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqs_PlantainCharcoal_Soap_Render3.jpg?v=1596329052","\/\/\/s\/files\/1\/0877\/4074\/products\/pumpkin_and_charcoal_cleansing_soap_jacqs.jpg?v=1595339712","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoapback.jpg?v=1596329041"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoap.jpg?v=1596329025","options":["Size"],"media":[{"alt":"JACQ'S BEAUTY \u0026 BATH BAR FOR CLEANSING \u0026 EXFOLIATING","id":7584497696816,"position":1,"preview_image":{"aspect_ratio":0.875,"height":1068,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoap.jpg?v=1596329025"},"aspect_ratio":0.875,"height":1068,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoap.jpg?v=1596329025","width":934},{"alt":"Black woman holding JACQ's activated charcoal face cleansing bar","id":812127977520,"position":2,"preview_image":{"aspect_ratio":0.825,"height":1552,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_soap_bar_jacqs.jpg?v=1595339712"},"aspect_ratio":0.825,"height":1552,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_soap_bar_jacqs.jpg?v=1595339712","width":1280},{"alt":"JACQ'S BEAUTY BAR PACKAGING, FRONT","id":7584433700912,"position":3,"preview_image":{"aspect_ratio":1.408,"height":2300,"width":3238,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqs_PlantainCharcoal_Soap_Render3.jpg?v=1596329052"},"aspect_ratio":1.408,"height":2300,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqs_PlantainCharcoal_Soap_Render3.jpg?v=1596329052","width":3238},{"alt":"JACQ's Skincare - organic face cleansing bars x 4","id":812127715376,"position":4,"preview_image":{"aspect_ratio":0.667,"height":1920,"width":1280,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/pumpkin_and_charcoal_cleansing_soap_jacqs.jpg?v=1595339712"},"aspect_ratio":0.667,"height":1920,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/pumpkin_and_charcoal_cleansing_soap_jacqs.jpg?v=1595339712","width":1280},{"alt":"JACQ'S BEAUTY BAR PACKAGING, PINK","id":7562146873392,"position":5,"preview_image":{"aspect_ratio":0.871,"height":1072,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoapback.jpg?v=1596329041"},"aspect_ratio":0.871,"height":1072,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsplantainandcharcoalsoapback.jpg?v=1596329041","width":934}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eUnclog Pores with JACQ's Plantain \u0026amp; Charcoal Face Cleansing Bar for Oily \u0026amp; Acne-Prone Skin\u003c\/h2\u003e\n\u003ch3\u003eWHAT IS IT?\u003c\/h3\u003e\n\u003cdiv\u003e\n\u003cspan\u003ePlantain peel and activated bamboo charcoal are the two main ingredients in this intoxicating cleansing bar to gently scrub away the day. Use it on your face or body, this bar is ideal for clogged pores, oily skin and acne-prone skin. The bamboo charcoal works to absorb oils and toxins from the body. T\u003c\/span\u003ehe combination\u003cspan\u003e of plantain, oils and activated charcoal delivers nutrients, \u003c\/span\u003eminerals\u003cspan\u003e and vitamins that work together to heal and protect skin. \u003c\/span\u003eGot annoying blemishes on your face, back and arms? Then we've got you covered. Give our cleansing bar a try. AVAILABLE IN A SMALLER SIZE. \u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003ch3\u003e\u003cstrong\u003eJACQ'S VEGAN-FRIENDLY PLANTAIN \u0026amp; CHARCOAL FACE CLEANSING BAR DETAILS:\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"ALL SKIN TYPES ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cimg alt=\"VEGAN-FRIENDLY BIRD ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_small.jpg?v=1499303284\" style=\"float: none;\"\u003e\u003cimg alt=\"CRUELTY-FREE BUNNY ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_small.jpg?v=1499297299\" style=\"float: none;\"\u003e  \u003cimg alt=\"ORGANIC INGREDIENTS LEAF ICON\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003cimg alt=\"UNICORN ICON, HANDMADE IN SMALL BATCHES\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003ch3 style=\"text-align: left;\"\u003e\u003cstrong\u003eWHAT'S IN JACQ'S PLANTAIN \u0026amp; ACTIVATED CHARCOAL CLEANSING BAR:\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cdiv style=\"text-align: left;\"\u003eSaponified oils of Cocos Nucifera (Coconut) Oil, Helianthus Annuus (Sunflower) Seed Oil, Theobroma Cacao (Cocoa) Seed Butter, Aloe Barbadensis Leaf Juice, Plantago (Plantain) Peel Powder *Palma Christi (Haitian Castor Oil), *Activated Bamboo Charcoal, *Citrus Medica Limonum (Lemon) Oil, Pinus (Pine Needle) Sylvestris leaf Oil and Pure Essential Oils. *Certified Organic\u003cbr\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cstrong\u003e\u003cspan\u003ePrecaution: \u003c\/span\u003e\u003c\/strong\u003e\u003cspan\u003eFOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cul class=\"tabs-content\"\u003e\u003c\/ul\u003e"}

JACQ's Plantain & Activated Charcoal Face Cleansing Bar

$ 7.50
Unclog Pores with JACQ's Plantain & Charcoal Face Cleansing Bar for Oily & Acne-Prone Skin WHAT IS IT? Plantain peel and activated bamboo charcoal are the two main ingredients in this intoxicating cleansing bar to gently scrub away the day. Use it on your face or body, this bar is...
JACQ's Healing Face Cleanser JACQ's Healing Face Cleanser
{"id":10500323523,"title":"JACQ's Healing Face Cleanser","handle":"healing-face-cleanser","description":"\u003ch3\u003e\u003c\/h3\u003e\n\u003ch2\u003eJACQ's Vegan, Cruelty-free Face Cleanser with Papaya \u0026amp; Moringa Extract\u003c\/h2\u003e\n\u003ch3\u003eFace Cleanser for Oily \u0026amp; Combination Skin \u003c\/h3\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003e\n\u003cspan\u003eA game-changing face cleanser that \u003c\/span\u003e\u003cstrong\u003edissolves dirt, makeup, and impurities on the skin.\u003c\/strong\u003e\u003cspan\u003e Creamy in texture, pink in color this cleanser is formulated with rich \u003c\/span\u003e\u003cstrong\u003eAmino Acids, Fruit Enzymes\u003c\/strong\u003e\u003cspan\u003e found in \u003c\/span\u003e\u003cstrong\u003ePapaya Extract\u003c\/strong\u003e\u003cspan\u003e to gently remove dead cells. Skin conditioning \u003c\/span\u003e\u003cstrong\u003eVitamin B3\u003c\/strong\u003e\u003cspan\u003e and healing \u003c\/span\u003e\u003cstrong\u003eMoringa Extract\u003c\/strong\u003e\u003cspan\u003e all work together to leave skin feeling clean and refreshed.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e\u003cspan\u003eWater (Aqua), *Helianthus Annuus (Sunflower) Seed Oil, *Cocos Nucifera (Coconut) Oil, *Ricinus Communis (Castor) Seed Oil, , Potassium hydroxide, *Glycerin, *Citric acid, Moringa Oleifera Seed Extract, Carica Papaya (Papaya) Fruit Extract, Spearmint Oil, Eucalyptus Oil, Peppermint Oil, Ginger Oil, Pure Essential Oils and Kaolinite (Rose Clay). *Certified Organic\u003c\/span\u003e\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cspan\u003eMassage onto wet skin, work into a lather, inhale the aroma and rinse. Avoid eye area.\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003ch2\u003e\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003ePapaya \u003c\/b\u003ehigh in Vitamin A \u0026amp; E, omega-fatty acids, and papain enzymes. Papain enzymes work to gently exfoliate the skin while removing dead skin cells.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eMoringa \u003c\/b\u003eis a rich source of fatty acids great for nourishing the skin. It easily absorbs into skin, a powerful plant that fights inflammation and helps protect against free-radical damage.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Clay\u003c\/strong\u003e easily \u003cspan\u003eabsorb impurities from the\u003cstrong\u003e \u003c\/strong\u003e\u003c\/span\u003eskin\u003cspan\u003e, such as dirt, makeup, and oils.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\"\u003e\u003c\/strong\u003e\u003c\/p\u003e","published_at":"2017-07-14T12:13:43-04:00","created_at":"2017-06-09T14:55:17-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":[],"price":1100,"price_min":1100,"price_max":2400,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40633316483,"title":"4oz","option1":"4oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793182748720,"product_id":10500323523,"position":3,"created_at":"2021-08-09T17:15:55-04:00","updated_at":"2021-09-23T12:42:11-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_healing_face_cleanser_937x1075_dc2fbfe9-bc58-4d31-a8d7-fece0f081e01.jpg?v=1632415331","variant_ids":[40633316483]},"available":true,"name":"JACQ's Healing Face Cleanser - 4oz","public_title":"4oz","options":["4oz"],"price":2400,"weight":198,"compare_at_price":null,"inventory_quantity":378,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","featured_media":{"alt":null,"id":21058696282160,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_healing_face_cleanser_937x1075_dc2fbfe9-bc58-4d31-a8d7-fece0f081e01.jpg?v=1632415331"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":22497980317744,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15388578578480,"product_id":10500323523,"position":6,"created_at":"2020-07-16T07:28:45-04:00","updated_at":"2021-09-23T12:42:11-04:00","alt":null,"width":934,"height":1064,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront.jpg?v=1632415331","variant_ids":[22497980317744]},"available":true,"name":"JACQ's Healing Face Cleanser - 2oz","public_title":"2oz","options":["2oz"],"price":1100,"weight":57,"compare_at_price":null,"inventory_quantity":211,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","featured_media":{"alt":null,"id":7561972908080,"position":6,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront.jpg?v=1632415331"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JACQShealingfacemask937x1075f.jpg?v=1632415331","\/\/\/s\/files\/1\/0877\/4074\/products\/healingcleanser4ozrenderingfront.jpg?v=1632415331","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_healing_face_cleanser_937x1075_dc2fbfe9-bc58-4d31-a8d7-fece0f081e01.jpg?v=1632415331","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealingfacecleanser.png?v=1632415316","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQS_HEALING_FACE_CLEANSER_2_OZ_937X1075_c04780c2-6163-4953-8d10-137ebb71c5a5.jpg?v=1632415331","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront.jpg?v=1632415331"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JACQShealingfacemask937x1075f.jpg?v=1632415331","options":["Size"],"media":[{"alt":null,"id":21058703982640,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQShealingfacemask937x1075f.jpg?v=1632415331"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQShealingfacemask937x1075f.jpg?v=1632415331","width":937},{"alt":null,"id":20697463324720,"position":2,"preview_image":{"aspect_ratio":0.791,"height":1069,"width":846,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/healingcleanser4ozrenderingfront.jpg?v=1632415331"},"aspect_ratio":0.791,"height":1069,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/healingcleanser4ozrenderingfront.jpg?v=1632415331","width":846},{"alt":null,"id":21058696282160,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_healing_face_cleanser_937x1075_dc2fbfe9-bc58-4d31-a8d7-fece0f081e01.jpg?v=1632415331"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_healing_face_cleanser_937x1075_dc2fbfe9-bc58-4d31-a8d7-fece0f081e01.jpg?v=1632415331","width":937},{"alt":null,"id":21179935129648,"position":4,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealingfacecleanser.png?v=1632415316"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealingfacecleanser.png?v=1632415316","width":2048},{"alt":null,"id":21058696806448,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQS_HEALING_FACE_CLEANSER_2_OZ_937X1075_c04780c2-6163-4953-8d10-137ebb71c5a5.jpg?v=1632415331"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQS_HEALING_FACE_CLEANSER_2_OZ_937X1075_c04780c2-6163-4953-8d10-137ebb71c5a5.jpg?v=1632415331","width":937},{"alt":null,"id":7561972908080,"position":6,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront.jpg?v=1632415331"},"aspect_ratio":0.878,"height":1064,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront.jpg?v=1632415331","width":934}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch3\u003e\u003c\/h3\u003e\n\u003ch2\u003eJACQ's Vegan, Cruelty-free Face Cleanser with Papaya \u0026amp; Moringa Extract\u003c\/h2\u003e\n\u003ch3\u003eFace Cleanser for Oily \u0026amp; Combination Skin \u003c\/h3\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003e\n\u003cspan\u003eA game-changing face cleanser that \u003c\/span\u003e\u003cstrong\u003edissolves dirt, makeup, and impurities on the skin.\u003c\/strong\u003e\u003cspan\u003e Creamy in texture, pink in color this cleanser is formulated with rich \u003c\/span\u003e\u003cstrong\u003eAmino Acids, Fruit Enzymes\u003c\/strong\u003e\u003cspan\u003e found in \u003c\/span\u003e\u003cstrong\u003ePapaya Extract\u003c\/strong\u003e\u003cspan\u003e to gently remove dead cells. Skin conditioning \u003c\/span\u003e\u003cstrong\u003eVitamin B3\u003c\/strong\u003e\u003cspan\u003e and healing \u003c\/span\u003e\u003cstrong\u003eMoringa Extract\u003c\/strong\u003e\u003cspan\u003e all work together to leave skin feeling clean and refreshed.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e\u003cspan\u003eWater (Aqua), *Helianthus Annuus (Sunflower) Seed Oil, *Cocos Nucifera (Coconut) Oil, *Ricinus Communis (Castor) Seed Oil, , Potassium hydroxide, *Glycerin, *Citric acid, Moringa Oleifera Seed Extract, Carica Papaya (Papaya) Fruit Extract, Spearmint Oil, Eucalyptus Oil, Peppermint Oil, Ginger Oil, Pure Essential Oils and Kaolinite (Rose Clay). *Certified Organic\u003c\/span\u003e\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cspan\u003eMassage onto wet skin, work into a lather, inhale the aroma and rinse. Avoid eye area.\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003ch2\u003e\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003ePapaya \u003c\/b\u003ehigh in Vitamin A \u0026amp; E, omega-fatty acids, and papain enzymes. Papain enzymes work to gently exfoliate the skin while removing dead skin cells.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eMoringa \u003c\/b\u003eis a rich source of fatty acids great for nourishing the skin. It easily absorbs into skin, a powerful plant that fights inflammation and helps protect against free-radical damage.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Clay\u003c\/strong\u003e easily \u003cspan\u003eabsorb impurities from the\u003cstrong\u003e \u003c\/strong\u003e\u003c\/span\u003eskin\u003cspan\u003e, such as dirt, makeup, and oils.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_compact.jpg?v=1517023823\"\u003e\u003cimg alt=\"\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\"\u003e\u003c\/strong\u003e\u003c\/p\u003e"}

JACQ's Healing Face Cleanser

$ 11.00
JACQ's Vegan, Cruelty-free Face Cleanser with Papaya & Moringa Extract Face Cleanser for Oily & Combination Skin  PRODUCT INFO INGREDIENTS HOW TO USE A game-changing face cleanser that dissolves dirt, makeup, and impurities on the skin. Creamy in texture, pink in color this cleanser is formulated with rich Amino Acids, Fruit Enzymes found in Papaya Extract to...
JACQ'S Revitalizing Face Toner JACQ'S Revitalizing Face Toner
{"id":10471658243,"title":"JACQ'S Revitalizing Face Toner","handle":"revitalizing-face-toner","description":"\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eA\u003cstrong\u003e hydrating floral tea for your skin\u003c\/strong\u003e formulated with refreshing Mint, toning and moisturizing \u003cstrong\u003eHibiscus pedals and healing Burdock Root\u003c\/strong\u003e. A perfect blend of herbal extracts,\u003cstrong\u003e fatty acids, and vitamins\u003c\/strong\u003e, this toner was crafted to\u003cstrong\u003e restores skin pH balance. minimize the appearance of pores, tone and remove excess residue from makeup, dirt, and oils\u003c\/strong\u003e.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003eWater (Aqua), *Hibiscus Rosa Sinensis Linn (Hibiscus), *Mentha Citrus Sinensis (Orange Mint), Rosa Centifolia (Rose), *Prunus Amygdalus Dulcis (Sweet Almond) Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Arctium Lappa (Burdock) Extract, *Echinacea Purpurea Extract, *Rumex (Yellow Dock) Crispus Extract, *Chamomilla Recutita (Matricaria) Extract, *Rosa Moschata (Rosehip) Seed Oil, Hippophae Rhamnoides (Sea Buckthorn) Seed Oil, *Aloe Barbadensis Extract, Ubiquinone (CoQ10), Leucidal Liquid (Radish Root Ferment) and Pure Essential Oils . *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eAfter cleansing, moisten a cotton pad with the toner and gently wipe across the forehead, cheek, and throat in an upward with outward motions. Avoid eye area.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"color: #0b5394;\"\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003eBurdock Root \u003c\/b\u003econtains ingredients known for cleansing the lymphatic system. It's antifungal and antibacterial and an ideal ingredient for regulating oil production in the skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eCoQ10 \u003c\/b\u003eacts as an antioxidant, energizes your skin and helps improves skin elasticity.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eHibiscus\u003c\/strong\u003e is a natural astringent rich in calcium, magnesium, and iron. A cooling and refreshing source of vegetable acids and vitamins A, B6, B12,, 12 C \u0026amp; D. Great for acne and oily combination skin.\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:33-04:00","created_at":"2017-06-01T21:34:06-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["probiotics"],"price":2499,"price_min":2499,"price_max":2499,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40244950211,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15388612362288,"product_id":10471658243,"position":1,"created_at":"2020-07-16T07:34:52-04:00","updated_at":"2020-07-16T07:34:54-04:00","alt":null,"width":934,"height":1064,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","variant_ids":[40244950211]},"available":true,"name":"JACQ'S Revitalizing Face Toner - 2oz","public_title":"2oz","options":["2oz"],"price":2499,"weight":85,"compare_at_price":null,"inventory_quantity":78,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":7562006659120,"position":1,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsfacetoner937x1075.png?v=1657226523","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerfront.jpg?v=1657226523"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","options":["Size"],"media":[{"alt":null,"id":7562006659120,"position":1,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294"},"aspect_ratio":0.878,"height":1064,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback.jpg?v=1594899294","width":934},{"alt":null,"id":22440012349488,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsfacetoner937x1075.png?v=1657226523"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsfacetoner937x1075.png?v=1657226523","width":937},{"alt":null,"id":7562005446704,"position":3,"preview_image":{"aspect_ratio":0.871,"height":1070,"width":932,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerfront.jpg?v=1657226523"},"aspect_ratio":0.871,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerfront.jpg?v=1657226523","width":932}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eA\u003cstrong\u003e hydrating floral tea for your skin\u003c\/strong\u003e formulated with refreshing Mint, toning and moisturizing \u003cstrong\u003eHibiscus pedals and healing Burdock Root\u003c\/strong\u003e. A perfect blend of herbal extracts,\u003cstrong\u003e fatty acids, and vitamins\u003c\/strong\u003e, this toner was crafted to\u003cstrong\u003e restores skin pH balance. minimize the appearance of pores, tone and remove excess residue from makeup, dirt, and oils\u003c\/strong\u003e.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003eWater (Aqua), *Hibiscus Rosa Sinensis Linn (Hibiscus), *Mentha Citrus Sinensis (Orange Mint), Rosa Centifolia (Rose), *Prunus Amygdalus Dulcis (Sweet Almond) Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Arctium Lappa (Burdock) Extract, *Echinacea Purpurea Extract, *Rumex (Yellow Dock) Crispus Extract, *Chamomilla Recutita (Matricaria) Extract, *Rosa Moschata (Rosehip) Seed Oil, Hippophae Rhamnoides (Sea Buckthorn) Seed Oil, *Aloe Barbadensis Extract, Ubiquinone (CoQ10), Leucidal Liquid (Radish Root Ferment) and Pure Essential Oils . *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eAfter cleansing, moisten a cotton pad with the toner and gently wipe across the forehead, cheek, and throat in an upward with outward motions. Avoid eye area.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"color: #0b5394;\"\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003eBurdock Root \u003c\/b\u003econtains ingredients known for cleansing the lymphatic system. It's antifungal and antibacterial and an ideal ingredient for regulating oil production in the skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eCoQ10 \u003c\/b\u003eacts as an antioxidant, energizes your skin and helps improves skin elasticity.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eHibiscus\u003c\/strong\u003e is a natural astringent rich in calcium, magnesium, and iron. A cooling and refreshing source of vegetable acids and vitamins A, B6, B12,, 12 C \u0026amp; D. Great for acne and oily combination skin.\u003c\/li\u003e\n\u003c\/ul\u003e"}

JACQ'S Revitalizing Face Toner

$ 24.99
PRODUCT INFO INGREDIENTS HOW TO USE A hydrating floral tea for your skin formulated with refreshing Mint, toning and moisturizing Hibiscus pedals and healing Burdock Root. A perfect blend of herbal extracts, fatty acids, and vitamins, this toner was crafted to restores skin pH balance. minimize the appearance of pores,...
JACQ's Beta-Acid Acne Treatment JACQ's Beta-Acid Acne Treatment
{"id":10500476675,"title":"JACQ's Beta-Acid Acne Treatment","handle":"the-high-priestess-beauty-booster","description":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-06-09T16:32:27-04:00","vendor":"JACQ'S","type":"Skin Care","tags":[],"price":1900,"price_min":1900,"price_max":1900,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636551619,"title":"1\/2 oz","option1":"1\/2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793009504304,"product_id":10500476675,"position":3,"created_at":"2021-08-09T15:23:56-04:00","updated_at":"2021-08-09T15:49:07-04:00","alt":null,"width":934,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","variant_ids":[40636551619]},"available":true,"name":"JACQ's Beta-Acid Acne Treatment - 1\/2 oz","public_title":"1\/2 oz","options":["1\/2 oz"],"price":1900,"weight":5,"compare_at_price":null,"inventory_quantity":129,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","options":["Size"],"media":[{"alt":null,"id":21058558591024,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058521497648,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"},"aspect_ratio":0.869,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","width":934},{"alt":null,"id":21058521464880,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e"}

JACQ's Beta-Acid Acne Treatment

$ 19.00
JACQ's Fruit Acid & Probiotics Skin Booster  PRODUCT INFO INGREDIENTS HOW TO USE Meet The High Priestess known for her abundance of Fruit Acid & AHA boosting ingredients. With over 20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple...
JACQ's Wild Hibiscus & Carrot Cleansing Bar JACQ's hibiscus & carrot cleansing bar, pink packaging
{"id":648924995,"title":"JACQ's Wild Hibiscus \u0026 Carrot Cleansing Bar","handle":"hibiscus-carrot-cleansing-bar","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Certified Organic Moisturizing Rice Milk \u0026amp; Aloe Vera Soap Bar\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT IS IT?\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003eOrganic carrots, organic rice milk, and moisturizing Aloe vera in each and every batch of our carrot con Leche cleansing bars. The results are skin moisturizing, blemish fighting soft bubble producing dirt fighting goodness. Got annoying blemishes on your back and arms? Aging is an issue? Or your skin is really sensitive? Then JACQ's has you covered. Give our organic cleansing bar a try. Did we mention, it won't dry your skin out.  AVAILABLE IN A SMALLER SIZE. \u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eDETAILS:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_small.jpg?v=1499303284\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_small.jpg?v=1499297299\" alt=\"cruelty free, bunny icon\" style=\"float: none;\"\u003e  \u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" alt=\"organic ingredients, leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\" alt=\"handmade small batches, unicorn icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003eWHAT'S IN JACQ's HIBISCUS \u0026amp; CARROT CLEANSING BAR:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003eSaponified oils of Cocos Nucifera (Coconut) Oil, Helianthus Annuus (Sunflower) Seed Oil, Theobroma Cacao (Cocoa) Seed Butter, Sucrose, *Oryza Sativa (Rice) Milk, Organic Daucus (Carrots) Carota, Pelargonium Graveolens (Rose Geranium) Essential, and *Pure Essential Oils . *Certified Organic\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cstrong\u003e\u003cspan\u003ePrecaution: \u003c\/span\u003e\u003c\/strong\u003e\u003cspan\u003eFOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab3\"\u003e JACQ's uses fresh carrots in EVERY batch. Carrots are rich in vitamin A, beta-carotene, and antioxidants. These combinations of nutrients, minerals, and vitamins work together to help protect against free radical damage, hyper-pigmentation, acne, and premature wrinkles. Aloe vera is extremely moisturizing, healing and restores suppleness to the skin. We also use fresh aloe in every batch. This cleansing bar contains certified-organic coconut oil that helps create a bubbly soap bar. Acne scars, discoloration, and uneven skin tone can be annoying. Rice Milk used in Asia for centuries works to naturally even skin tone, hydrate, and shrink the appearance of enlarged pores. Combined with the carrots, the rice milk, carotenoids work together to lighten dark spots, seal in moisture and leave skin glowing.\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-11-10T07:07:27-05:00","created_at":"2015-05-26T14:35:43-04:00","vendor":"jacqsorganics","type":"Soap","tags":["ACNE","BLEMISHES","Carrot","carrot con leche","DARK SPOTS","HIBISCUS","HYPERPIGMENTATION","rice milk","soap"],"price":750,"price_min":750,"price_max":1300,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":32313779388464,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Wild Hibiscus \u0026 Carrot Cleansing Bar - 2oz","public_title":"2oz","options":["2oz"],"price":750,"weight":85,"compare_at_price":null,"inventory_quantity":115,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]},{"id":32313779421232,"title":"4oz","option1":"4oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Wild Hibiscus \u0026 Carrot Cleansing Bar - 4oz","public_title":"4oz","options":["4oz"],"price":1300,"weight":85,"compare_at_price":null,"inventory_quantity":176,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscuscarrotsoapbar937x1075.jpg?v=1628544508","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscusandwildcarrotbeautybarfront.jpg?v=1628544508","\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsHibiscusandWildCarrot937x1075.png?v=1657228452","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscusandcarrotbeautybar3_92c3c18f-2a2a-49c0-b921-81b54a791cdd.jpg?v=1657228452","\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsHibiscusandWildCarrot2937x1075.png?v=1657228515"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscuscarrotsoapbar937x1075.jpg?v=1628544508","options":["Size"],"media":[{"alt":null,"id":21058718924848,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscuscarrotsoapbar937x1075.jpg?v=1628544508"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscuscarrotsoapbar937x1075.jpg?v=1628544508","width":937},{"alt":"JACQ's hibiscus \u0026 carrot cleansing bar, pink packaging","id":7562081566768,"position":2,"preview_image":{"aspect_ratio":0.877,"height":1067,"width":936,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscusandwildcarrotbeautybarfront.jpg?v=1628544508"},"aspect_ratio":0.877,"height":1067,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscusandwildcarrotbeautybarfront.jpg?v=1628544508","width":936},{"alt":null,"id":22440177532976,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsHibiscusandWildCarrot937x1075.png?v=1657228452"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsHibiscusandWildCarrot937x1075.png?v=1657228452","width":937},{"alt":"2 JACQ's wild hibiscus \u0026 carrot cleansing bars, pink packaging","id":7562981605424,"position":4,"preview_image":{"aspect_ratio":0.88,"height":1064,"width":936,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscusandcarrotbeautybar3_92c3c18f-2a2a-49c0-b921-81b54a791cdd.jpg?v=1657228452"},"aspect_ratio":0.88,"height":1064,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshibiscusandcarrotbeautybar3_92c3c18f-2a2a-49c0-b921-81b54a791cdd.jpg?v=1657228452","width":936},{"alt":null,"id":22440181563440,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsHibiscusandWildCarrot2937x1075.png?v=1657228515"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsHibiscusandWildCarrot2937x1075.png?v=1657228515","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Certified Organic Moisturizing Rice Milk \u0026amp; Aloe Vera Soap Bar\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT IS IT?\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003eOrganic carrots, organic rice milk, and moisturizing Aloe vera in each and every batch of our carrot con Leche cleansing bars. The results are skin moisturizing, blemish fighting soft bubble producing dirt fighting goodness. Got annoying blemishes on your back and arms? Aging is an issue? Or your skin is really sensitive? Then JACQ's has you covered. Give our organic cleansing bar a try. Did we mention, it won't dry your skin out.  AVAILABLE IN A SMALLER SIZE. \u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eDETAILS:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_de9a4581-b62b-4089-887c-2d1d4ede9291_small.jpg?v=1499303284\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_small.jpg?v=1499297299\" alt=\"cruelty free, bunny icon\" style=\"float: none;\"\u003e  \u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" alt=\"organic ingredients, leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\" alt=\"handmade small batches, unicorn icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003eWHAT'S IN JACQ's HIBISCUS \u0026amp; CARROT CLEANSING BAR:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003eSaponified oils of Cocos Nucifera (Coconut) Oil, Helianthus Annuus (Sunflower) Seed Oil, Theobroma Cacao (Cocoa) Seed Butter, Sucrose, *Oryza Sativa (Rice) Milk, Organic Daucus (Carrots) Carota, Pelargonium Graveolens (Rose Geranium) Essential, and *Pure Essential Oils . *Certified Organic\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e.\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cstrong\u003e\u003cspan\u003ePrecaution: \u003c\/span\u003e\u003c\/strong\u003e\u003cspan\u003eFOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab3\"\u003e JACQ's uses fresh carrots in EVERY batch. Carrots are rich in vitamin A, beta-carotene, and antioxidants. These combinations of nutrients, minerals, and vitamins work together to help protect against free radical damage, hyper-pigmentation, acne, and premature wrinkles. Aloe vera is extremely moisturizing, healing and restores suppleness to the skin. We also use fresh aloe in every batch. This cleansing bar contains certified-organic coconut oil that helps create a bubbly soap bar. Acne scars, discoloration, and uneven skin tone can be annoying. Rice Milk used in Asia for centuries works to naturally even skin tone, hydrate, and shrink the appearance of enlarged pores. Combined with the carrots, the rice milk, carotenoids work together to lighten dark spots, seal in moisture and leave skin glowing.\u003c\/li\u003e\n\u003c\/ul\u003e"}

JACQ's Wild Hibiscus & Carrot Cleansing Bar

$ 7.50
JACQ's Certified Organic Moisturizing Rice Milk & Aloe Vera Soap Bar WHAT IS IT? Organic carrots, organic rice milk, and moisturizing Aloe vera in each and every batch of our carrot con Leche cleansing bars. The results are skin moisturizing, blemish fighting soft bubble producing dirt fighting goodness. Got annoying...
JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit
{"id":432966860829,"title":"JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit","handle":"heal-slay-kit-save-10","description":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Best-Selling Heal \u0026amp; Slay Vegan Skincare Trio: Face Cleanser, Toner, and Moisturizer\u003c\/span\u003e\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFORMATION\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHere's the perfect Heal and Slay Vegan Skincare Kit. This cruelty-free beauty kit contains our best sellers. Enjoy this magical trio including the JACQ's Healing Face Cleanser, Revitalizing Face Toner and Nourishing Face Moisturizer all work together to help you slay the day, that meeting, those exams or just to slay selfies. Slaying just got a lot easier!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e","published_at":"2017-07-11T19:04:06-04:00","created_at":"2018-03-08T15:45:59-05:00","vendor":"Jacq's Organics","type":"Gifts","tags":["bundle","coconut","CoQ10","face cleanser","face moisturizer","face toner","heal \u0026 slay kit","moringa","trio","yucca"],"price":7100,"price_min":7100,"price_max":7100,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":32324153049136,"title":"Full size","option1":"Full size","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit - Full size","public_title":"Full size","options":["Full size"],"price":7100,"weight":371,"compare_at_price":null,"inventory_quantity":120,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealandkitboxes.jpg?v=1649449002","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit.png?v=1649449002"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002","options":["Size:"],"media":[{"alt":null,"id":22002511708208,"position":1,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002","width":2048},{"alt":null,"id":21058647392304,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealandkitboxes.jpg?v=1649449002"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealandkitboxes.jpg?v=1649449002","width":937},{"alt":null,"id":21179951677488,"position":3,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit.png?v=1649449002"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit.png?v=1649449002","width":2048}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Best-Selling Heal \u0026amp; Slay Vegan Skincare Trio: Face Cleanser, Toner, and Moisturizer\u003c\/span\u003e\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFORMATION\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHere's the perfect Heal and Slay Vegan Skincare Kit. This cruelty-free beauty kit contains our best sellers. Enjoy this magical trio including the JACQ's Healing Face Cleanser, Revitalizing Face Toner and Nourishing Face Moisturizer all work together to help you slay the day, that meeting, those exams or just to slay selfies. Slaying just got a lot easier!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e"}

JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit

$ 71.00
JACQ's Best-Selling Heal & Slay Vegan Skincare Trio: Face Cleanser, Toner, and Moisturizer PRODUCT INFORMATION Here's the perfect Heal and Slay Vegan Skincare Kit. This cruelty-free beauty kit contains our best sellers. Enjoy this magical trio including the JACQ's Healing Face Cleanser, Revitalizing Face Toner and Nourishing Face Moisturizer all...
JACQ's Clarifying Green Smoothie Face Masque and Scrub JACQ's Clarifying Green Smoothie Face Masque and Scrub
{"id":10500475139,"title":"JACQ's Clarifying Green Smoothie Face Masque and Scrub","handle":"jacqs-clarifying-green-smoothie-face-mask-scrub","description":"\u003ch2\u003eJACQ's Green Smoothie Organic Face Mask \u0026amp; Scrub with Charcoal and Sea Salt\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eIt's all about the face mask. JACQ's Green Smoothie Face Masque and Scrub aka Clarifying Mask contains an abundance of Minerals, Botanical Peptides and Rich Clays that work to help get oxygen into skin cells. Our blend of Montmorillonite Clay, Activated Charcoal, and Dead Sea Salt paired together with olive-derived Squalane to draw out impurities while nourishing the skin. Protective Vitamin B3, the natural fruit acids extracts, and our proprietary essential oil blend leaves your skin feeling refreshed, cool and clean.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Rhassoul Clay (Moroccan Lava Clay), *Bentonite Clay, *Zea Mays (Corn) Starch, *Bamboo Activated Charcoal Powder, *Tapioca Starch, *Ascophyllum (Kelp Powder) Nodosum Powder, Calophyllum Inophyllum (Tamanu) Oil. Sodium Chloride (Dead Sea Salt), Niacinamide, Spearmint Oil, Lavender Oil, Rosmarinus Officinalis (Rosemary) Oil, Citrus Limonium (Lemon) Oil, Galangal Extract and Pure Essential Oils. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e45ML - Mix 1\/4 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation. 20ML - Mix 1\/8 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e30 ACTIVE INGREDIENTS IN JACQ'S GREEN SMOOTHIE ORGANIC FACE MASQUE \u0026amp; SCRUB\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e \u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"organic leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\" alt=\"oily\/combination skin, globe icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e","published_at":"2017-07-14T12:13:43-04:00","created_at":"2017-06-09T16:31:39-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["charcoal","essential oils","exfoliate","face scrub","green smoothie face mask","lavender","lemon","Moroccan","organic"],"price":1700,"price_min":1700,"price_max":2700,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636537923,"title":"2 oz","option1":"2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":30101985886256,"product_id":10500475139,"position":1,"created_at":"2022-07-07T16:01:43-04:00","updated_at":"2022-07-07T16:01:49-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","variant_ids":[40636537923]},"available":true,"name":"JACQ's Clarifying Green Smoothie Face Masque and Scrub - 2 oz","public_title":"2 oz","options":["2 oz"],"price":2700,"weight":71,"compare_at_price":null,"inventory_quantity":74,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":22439797260336,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":41905034243,"title":"45 ml","option1":"45 ml","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":30101999845424,"product_id":10500475139,"position":5,"created_at":"2022-07-07T16:05:04-04:00","updated_at":"2022-07-07T16:05:04-04:00","alt":null,"width":935,"height":1070,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304","variant_ids":[41905034243]},"available":true,"name":"JACQ's Clarifying Green Smoothie Face Masque and Scrub - 45 ml","public_title":"45 ml","options":["45 ml"],"price":1700,"weight":168,"compare_at_price":null,"inventory_quantity":129,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":22439813480496,"position":5,"preview_image":{"aspect_ratio":0.874,"height":1070,"width":935,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASKFRONT_9a207218-6f87-441f-a19a-3518ae6259bf.jpg?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask_1.png?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_face_mask_caasi1024X1024.jpg?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","options":["Size"],"media":[{"alt":null,"id":22439797260336,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","width":937},{"alt":null,"id":7584607666224,"position":2,"preview_image":{"aspect_ratio":0.874,"height":1067,"width":933,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASKFRONT_9a207218-6f87-441f-a19a-3518ae6259bf.jpg?v=1657224109"},"aspect_ratio":0.874,"height":1067,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASKFRONT_9a207218-6f87-441f-a19a-3518ae6259bf.jpg?v=1657224109","width":933},{"alt":null,"id":7584659111984,"position":3,"preview_image":{"aspect_ratio":0.874,"height":435,"width":380,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask_1.png?v=1657224109"},"aspect_ratio":0.874,"height":435,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask_1.png?v=1657224109","width":380},{"alt":"Black woman wearing JACQ's green smoothie face mask, drinking tea","id":435672875056,"position":4,"preview_image":{"aspect_ratio":1.0,"height":1024,"width":1024,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_face_mask_caasi1024X1024.jpg?v=1657224109"},"aspect_ratio":1.0,"height":1024,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_face_mask_caasi1024X1024.jpg?v=1657224109","width":1024},{"alt":null,"id":22439813480496,"position":5,"preview_image":{"aspect_ratio":0.874,"height":1070,"width":935,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304"},"aspect_ratio":0.874,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304","width":935}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Green Smoothie Organic Face Mask \u0026amp; Scrub with Charcoal and Sea Salt\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eIt's all about the face mask. JACQ's Green Smoothie Face Masque and Scrub aka Clarifying Mask contains an abundance of Minerals, Botanical Peptides and Rich Clays that work to help get oxygen into skin cells. Our blend of Montmorillonite Clay, Activated Charcoal, and Dead Sea Salt paired together with olive-derived Squalane to draw out impurities while nourishing the skin. Protective Vitamin B3, the natural fruit acids extracts, and our proprietary essential oil blend leaves your skin feeling refreshed, cool and clean.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Rhassoul Clay (Moroccan Lava Clay), *Bentonite Clay, *Zea Mays (Corn) Starch, *Bamboo Activated Charcoal Powder, *Tapioca Starch, *Ascophyllum (Kelp Powder) Nodosum Powder, Calophyllum Inophyllum (Tamanu) Oil. Sodium Chloride (Dead Sea Salt), Niacinamide, Spearmint Oil, Lavender Oil, Rosmarinus Officinalis (Rosemary) Oil, Citrus Limonium (Lemon) Oil, Galangal Extract and Pure Essential Oils. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e45ML - Mix 1\/4 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation. 20ML - Mix 1\/8 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e30 ACTIVE INGREDIENTS IN JACQ'S GREEN SMOOTHIE ORGANIC FACE MASQUE \u0026amp; SCRUB\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e \u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"organic leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\" alt=\"oily\/combination skin, globe icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e"}

JACQ's Clarifying Green Smoothie Face Masque and Scrub

$ 17.00
JACQ's Green Smoothie Organic Face Mask & Scrub with Charcoal and Sea Salt PRODUCT INFO INGREDIENTS HOW TO USE It's all about the face mask. JACQ's Green Smoothie Face Masque and Scrub aka Clarifying Mask contains an abundance of Minerals, Botanical Peptides and Rich Clays that work to help get oxygen into skin cells. Our...
JACQ's Clear Essentials Skincare Kit
{"id":2155883003952,"title":"JACQ's Clear Essentials Skincare Kit","handle":"jacqs-skincare-holiday-gift-set","description":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Skincare Gift Set\u003c\/span\u003e\u003c\/h2\u003e\n\u003cbr\u003eGet healthy, radiant skin with this on the go glow essentials kit. Gently cleanse away dirt without stripping your skin of essential nutrients and moisture with our Healing Face Cleanser followed by our delicious Revitalizing Face Toner and tone your skin. Then hydrate and restore with our Balancing Face Serum packed with omega fatty acids to remedy breakouts and premature aging. Treat yourself to this magical trio. Slaying just got a lot easier!\u003cbr\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"Organic ingredients, leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\" alt=\"cruelty-free, cat icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e","published_at":"2017-07-11T19:04:06-04:00","created_at":"2018-11-23T09:39:24-05:00","vendor":"Jacq's Organics","type":"Gifts","tags":["cleanser","face cleanser","face serum","face toner","gift set","holiday gift set"],"price":7500,"price_min":7500,"price_max":7500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":21665727643696,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Clear Essentials Skincare Kit","public_title":null,"options":["Default Title"],"price":7500,"weight":283,"compare_at_price":null,"inventory_quantity":222,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197","options":["Title"],"media":[{"alt":null,"id":7584341229616,"position":1,"preview_image":{"aspect_ratio":0.87,"height":1071,"width":932,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197"},"aspect_ratio":0.87,"height":1071,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197","width":932}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Skincare Gift Set\u003c\/span\u003e\u003c\/h2\u003e\n\u003cbr\u003eGet healthy, radiant skin with this on the go glow essentials kit. Gently cleanse away dirt without stripping your skin of essential nutrients and moisture with our Healing Face Cleanser followed by our delicious Revitalizing Face Toner and tone your skin. Then hydrate and restore with our Balancing Face Serum packed with omega fatty acids to remedy breakouts and premature aging. Treat yourself to this magical trio. Slaying just got a lot easier!\u003cbr\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"Organic ingredients, leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\" alt=\"cruelty-free, cat icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e"}

JACQ's Clear Essentials Skincare Kit

$ 75.00
JACQ's Skincare Gift Set Get healthy, radiant skin with this on the go glow essentials kit. Gently cleanse away dirt without stripping your skin of essential nutrients and moisture with our Healing Face Cleanser followed by our delicious Revitalizing Face Toner and tone your skin. Then hydrate and restore with our Balancing...
JACQ's Healing Face Cleanser + Toner Skincare Duo JACQ's Healing Face Cleanser + Toner Skincare Duo
{"id":2156917456944,"title":"JACQ's Healing Face Cleanser + Toner Skincare Duo","handle":"jacqs-cleanser-toner-skincare-duo","description":"\u003ch2\u003eJACQ's Vegan Face Cleanser \u0026amp; Toner with Papaya, Rosemary, and Essential Oils\u003c\/h2\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\"\u003e\n\u003cstrong\u003eHydrating and heal your skin \u003c\/strong\u003ewith JACQ's Vegan, Cruelty-free Healing Face Cleanser, and Revitalizing Face Toner. Enriched with Papaya enzyme, rosemary, and lime essential oils.\u003cstrong\u003e This all-natural face toner is\u003c\/strong\u003e formulated with refreshing Mint, toning, and moisturizing \u003cstrong\u003eHibiscus pedals and healing Burdock Root\u003c\/strong\u003e. A perfect blend of herbal extracts,\u003cstrong\u003e fatty acids, and vitamins\u003c\/strong\u003e, this toner was crafted to\u003cstrong\u003e restores skin pH balance. minimize the appearance of pores, tone and remove excess residue from makeup, dirt, and oils\u003c\/strong\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eAfter cleansing, moisten a cotton pad with the toner and gently wipe across the forehead, cheek, and throat in an upward with outward motions. Avoid the eye area.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"color: #0b5394;\"\u003e\u003cstrong\u003e27+ ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003ch3\u003e\u003cstrong\u003eJACQ'S FACE CLEANSER \u0026amp; TONER KEY INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003eBurdock Root \u003c\/b\u003econtains ingredients known for cleansing the lymphatic system. It's antifungal and antibacterial and an ideal ingredient for regulating oil production in the skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eCoQ10 \u003c\/b\u003eacts as an antioxidant, energizes your skin, and helps improves skin elasticity.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eHibiscus\u003c\/strong\u003e is a natural astringent rich in calcium, magnesium, and iron. A cooling and refreshing source of vegetable acids and vitamins A, B6, B12, 12 C \u0026amp; D. Great for acne and oily combination skin.\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:33-04:00","created_at":"2018-11-24T12:51:58-05:00","vendor":"Jacq's Organics","type":"Skin Care","tags":[],"price":4300,"price_min":4300,"price_max":4300,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":21674988503088,"title":"6oz","option1":"6oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Healing Face Cleanser + Toner Skincare Duo - 6oz","public_title":"6oz","options":["6oz"],"price":4300,"weight":170,"compare_at_price":null,"inventory_quantity":83,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_moisturizer2048x2048_1.png?v=1649449198","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback_3cd2d3e8-3c3e-42b5-8fe5-24cdc082b532.jpg?v=1649449197","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_moisturizer2048x2048_2.png?v=1649449236"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_moisturizer2048x2048_1.png?v=1649449198","options":["Size"],"media":[{"alt":null,"id":22002528550960,"position":1,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_moisturizer2048x2048_1.png?v=1649449198"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_moisturizer2048x2048_1.png?v=1649449198","width":2048},{"alt":null,"id":7562699210800,"position":2,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback_3cd2d3e8-3c3e-42b5-8fe5-24cdc082b532.jpg?v=1649449197"},"aspect_ratio":0.878,"height":1064,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrevitalizingfacetonerback_3cd2d3e8-3c3e-42b5-8fe5-24cdc082b532.jpg?v=1649449197","width":934},{"alt":null,"id":22002530123824,"position":3,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_moisturizer2048x2048_2.png?v=1649449236"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_moisturizer2048x2048_2.png?v=1649449236","width":2048}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Vegan Face Cleanser \u0026amp; Toner with Papaya, Rosemary, and Essential Oils\u003c\/h2\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\"\u003e\n\u003cstrong\u003eHydrating and heal your skin \u003c\/strong\u003ewith JACQ's Vegan, Cruelty-free Healing Face Cleanser, and Revitalizing Face Toner. Enriched with Papaya enzyme, rosemary, and lime essential oils.\u003cstrong\u003e This all-natural face toner is\u003c\/strong\u003e formulated with refreshing Mint, toning, and moisturizing \u003cstrong\u003eHibiscus pedals and healing Burdock Root\u003c\/strong\u003e. A perfect blend of herbal extracts,\u003cstrong\u003e fatty acids, and vitamins\u003c\/strong\u003e, this toner was crafted to\u003cstrong\u003e restores skin pH balance. minimize the appearance of pores, tone and remove excess residue from makeup, dirt, and oils\u003c\/strong\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eAfter cleansing, moisten a cotton pad with the toner and gently wipe across the forehead, cheek, and throat in an upward with outward motions. Avoid the eye area.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"color: #0b5394;\"\u003e\u003cstrong\u003e27+ ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003ch3\u003e\u003cstrong\u003eJACQ'S FACE CLEANSER \u0026amp; TONER KEY INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003eBurdock Root \u003c\/b\u003econtains ingredients known for cleansing the lymphatic system. It's antifungal and antibacterial and an ideal ingredient for regulating oil production in the skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eCoQ10 \u003c\/b\u003eacts as an antioxidant, energizes your skin, and helps improves skin elasticity.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eHibiscus\u003c\/strong\u003e is a natural astringent rich in calcium, magnesium, and iron. A cooling and refreshing source of vegetable acids and vitamins A, B6, B12, 12 C \u0026amp; D. Great for acne and oily combination skin.\u003c\/li\u003e\n\u003c\/ul\u003e"}

JACQ's Healing Face Cleanser + Toner Skincare Duo

$ 43.00
JACQ's Vegan Face Cleanser & Toner with Papaya, Rosemary, and Essential Oils Hydrating and heal your skin with JACQ's Vegan, Cruelty-free Healing Face Cleanser, and Revitalizing Face Toner. Enriched with Papaya enzyme, rosemary, and lime essential oils. This all-natural face toner is formulated with refreshing Mint, toning, and moisturizing Hibiscus pedals and...
{"id":2156921225264,"title":"JACQ's Beauty Bar Trio + Revitalizing Face Toner","handle":"soap-bar-face-toner-skincare-gift-set","description":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Beauty Bar \u0026amp; Face Toner Organic Skincare Bundle \u003c\/span\u003e\u003c\/h2\u003e\n\u003cp\u003eDiscover and enjoy our beauty bars and our Revitalizing Face Toner. The perfect set to enjoy our hand-crafted bars for yourself, your mom, your wife, your sissy or a co-worker.  \u003c\/p\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"color: #0b5394;\"\u003e\u003cstrong\u003e *Order comes with 2oz beauty bars.\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003eBurdock Root \u003c\/b\u003econtains ingredients known for cleansing the lymphatic system. It's antifungal and antibacterial and an ideal ingredient for regulating oil production in the skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eCoQ10 \u003c\/b\u003eacts as an antioxidant energize your skin and help improves skin elasticity.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eHibiscus\u003c\/strong\u003e is a natural astringent rich in calcium, magnesium, and iron. A cooling and refreshing source of vegetable acids and vitamins A, B6, B12,, 12 C \u0026amp; D. Great for acne and oily combination skin.\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:33-04:00","created_at":"2018-11-24T13:03:12-05:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["beauty bar","burdock root","CoQ10","face toner","gift set","HIBISCUS"],"price":3500,"price_min":3500,"price_max":3500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":21675090477104,"title":"6oz","option1":"6oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15389385359408,"product_id":2156921225264,"position":1,"created_at":"2020-07-16T10:33:02-04:00","updated_at":"2020-08-01T20:47:12-04:00","alt":"3 JACQ'S BEAUTY BARS, 1 BOTTLE HIBISCUS FACE TONER ","width":934,"height":1069,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoapbartrioandfacetoner.jpg?v=1596329232","variant_ids":[21675090477104]},"available":true,"name":"JACQ's Beauty Bar Trio + Revitalizing Face Toner - 6oz","public_title":"6oz","options":["6oz"],"price":3500,"weight":170,"compare_at_price":null,"inventory_quantity":96,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":"3 JACQ'S BEAUTY BARS, 1 BOTTLE HIBISCUS FACE TONER ","id":7562779852848,"position":1,"preview_image":{"aspect_ratio":0.874,"height":1069,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoapbartrioandfacetoner.jpg?v=1596329232"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoapbartrioandfacetoner.jpg?v=1596329232"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoapbartrioandfacetoner.jpg?v=1596329232","options":["Size"],"media":[{"alt":"3 JACQ'S BEAUTY BARS, 1 BOTTLE HIBISCUS FACE TONER ","id":7562779852848,"position":1,"preview_image":{"aspect_ratio":0.874,"height":1069,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoapbartrioandfacetoner.jpg?v=1596329232"},"aspect_ratio":0.874,"height":1069,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoapbartrioandfacetoner.jpg?v=1596329232","width":934}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Beauty Bar \u0026amp; Face Toner Organic Skincare Bundle \u003c\/span\u003e\u003c\/h2\u003e\n\u003cp\u003eDiscover and enjoy our beauty bars and our Revitalizing Face Toner. The perfect set to enjoy our hand-crafted bars for yourself, your mom, your wife, your sissy or a co-worker.  \u003c\/p\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"color: #0b5394;\"\u003e\u003cstrong\u003e *Order comes with 2oz beauty bars.\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003eBurdock Root \u003c\/b\u003econtains ingredients known for cleansing the lymphatic system. It's antifungal and antibacterial and an ideal ingredient for regulating oil production in the skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eCoQ10 \u003c\/b\u003eacts as an antioxidant energize your skin and help improves skin elasticity.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eHibiscus\u003c\/strong\u003e is a natural astringent rich in calcium, magnesium, and iron. A cooling and refreshing source of vegetable acids and vitamins A, B6, B12,, 12 C \u0026amp; D. Great for acne and oily combination skin.\u003c\/li\u003e\n\u003c\/ul\u003e"}

JACQ's Beauty Bar Trio + Revitalizing Face Toner

$ 35.00
JACQ's Beauty Bar & Face Toner Organic Skincare Bundle  Discover and enjoy our beauty bars and our Revitalizing Face Toner. The perfect set to enjoy our hand-crafted bars for yourself, your mom, your wife, your sissy or a co-worker.    *Order comes with 2oz beauty bars. KEY INGREDIENTS Burdock Root contains ingredients...
JACQ's Travel Size Organic Healing Face Cleanser JACQ's healing face cleanser, pink label, clear bottle
{"id":2157874118704,"title":"JACQ's Travel Size Organic Healing Face Cleanser","handle":"mini-healing-face-cleanser","description":"\u003ch3\u003e\u003c\/h3\u003e\n\u003ch2\u003eJACQ's Vegan, Cruelty-Free Face Cleanser for Oily\/Combination Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003e\n\u003cspan\u003eNow in a travel size, JACQ's game-changing organic, vegan \u0026amp; cruelty-free face cleanser \u003c\/span\u003e\u003cstrong\u003edissolves dirt, makeup, and impurities on the skin.\u003c\/strong\u003e\u003cspan\u003e Creamy in texture, pink in color this face cleanser is formulated with rich \u003c\/span\u003e\u003cstrong\u003eAmino Acids, Fruit Enzymes\u003c\/strong\u003e\u003cspan\u003e found in \u003c\/span\u003e\u003cstrong\u003ePapaya Extract\u003c\/strong\u003e\u003cspan\u003e to gently remove dead cells. Skin conditioning \u003c\/span\u003e\u003cstrong\u003eVitamin B3\u003c\/strong\u003e\u003cspan\u003e and healing \u003c\/span\u003e\u003cstrong\u003eMoringa Extract\u003c\/strong\u003e\u003cspan\u003e all work together to leave the skin feeling clean and refreshed.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e\u003cspan\u003eWater (Aqua), *Helianthus Annuus (Sunflower) Seed Oil, *Cocos Nucifera (Coconut) Oil, *Ricinus Communis (Castor) Seed Oil, , Potassium hydroxide, *Glycerin, *Citric acid, Moringa Oleifera Seed Extract, Carica Papaya (Papaya) Fruit Extract, Spearmint Oil, Eucalyptus Oil, Peppermint Oil, Ginger Oil, Pure Essential Oils and Kaolinite (Rose Clay). *Certified Organic\u003c\/span\u003e\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cspan\u003eMassage onto wet skin, work into a lather, inhale the aroma and rinse. Avoid eye area.\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003ch4\u003e\u003cstrong\u003eJACQ's KEY INGREDIENTS\u003c\/strong\u003e\u003c\/h4\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003ePapaya \u003c\/b\u003ehigh in Vitamin A \u0026amp; E, omega fatty acids, and papain enzymes. Papain enzymes work to gently exfoliate the skin while removing dead skin cells.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eMoringa \u003c\/b\u003eis a rich source of fatty acids great for nourishing the skin. It easily absorbs into skin, a powerful plant that fights inflammation and helps protect against free-radical damage.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Clay\u003c\/strong\u003e easily \u003cspan\u003eabsorbs impurities from the\u003cstrong\u003e \u003c\/strong\u003e\u003c\/span\u003eskin\u003cspan\u003e, such as dirt, makeup, and oils.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"Organic Ingredients, Leaf icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_compact.jpg?v=1517023823\" alt=\"vegan friendly, pig icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\" alt=\"oily\/combination skin, globe icon\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e","published_at":"2017-07-14T12:13:43-04:00","created_at":"2018-11-26T11:16:27-05:00","vendor":"Jacq's Organics","type":"Skin Care","tags":[],"price":1000,"price_min":1000,"price_max":1000,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":21688097177648,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15389311074352,"product_id":2157874118704,"position":2,"created_at":"2020-07-16T10:14:44-04:00","updated_at":"2021-08-09T17:22:22-04:00","alt":"JACQ's healing face cleanser, pink label, clear bottle","width":934,"height":1064,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront_8c75afcb-c833-436f-8040-9edd6529cca3.jpg?v=1628544142","variant_ids":[21688097177648]},"available":true,"name":"JACQ's Travel Size Organic Healing Face Cleanser - 2oz","public_title":"2oz","options":["2oz"],"price":1000,"weight":170,"compare_at_price":null,"inventory_quantity":495,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","featured_media":{"alt":"JACQ's healing face cleanser, pink label, clear bottle","id":7562705862704,"position":2,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront_8c75afcb-c833-436f-8040-9edd6529cca3.jpg?v=1628544142"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSHEALINGFACECLEANSER2OZ937X1075.jpg?v=1628544142","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront_8c75afcb-c833-436f-8040-9edd6529cca3.jpg?v=1628544142","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserback_ce167975-3071-4148-aeff-273f857b4aef.jpg?v=1628544142"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSHEALINGFACECLEANSER2OZ937X1075.jpg?v=1628544142","options":["Size"],"media":[{"alt":null,"id":21058709880880,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSHEALINGFACECLEANSER2OZ937X1075.jpg?v=1628544142"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSHEALINGFACECLEANSER2OZ937X1075.jpg?v=1628544142","width":937},{"alt":"JACQ's healing face cleanser, pink label, clear bottle","id":7562705862704,"position":2,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront_8c75afcb-c833-436f-8040-9edd6529cca3.jpg?v=1628544142"},"aspect_ratio":0.878,"height":1064,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront_8c75afcb-c833-436f-8040-9edd6529cca3.jpg?v=1628544142","width":934},{"alt":"JACQ's travel size face cleanser, pink label, skincare ingredients","id":7562705829936,"position":3,"preview_image":{"aspect_ratio":0.863,"height":1070,"width":923,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserback_ce167975-3071-4148-aeff-273f857b4aef.jpg?v=1628544142"},"aspect_ratio":0.863,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserback_ce167975-3071-4148-aeff-273f857b4aef.jpg?v=1628544142","width":923}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch3\u003e\u003c\/h3\u003e\n\u003ch2\u003eJACQ's Vegan, Cruelty-Free Face Cleanser for Oily\/Combination Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003e\n\u003cspan\u003eNow in a travel size, JACQ's game-changing organic, vegan \u0026amp; cruelty-free face cleanser \u003c\/span\u003e\u003cstrong\u003edissolves dirt, makeup, and impurities on the skin.\u003c\/strong\u003e\u003cspan\u003e Creamy in texture, pink in color this face cleanser is formulated with rich \u003c\/span\u003e\u003cstrong\u003eAmino Acids, Fruit Enzymes\u003c\/strong\u003e\u003cspan\u003e found in \u003c\/span\u003e\u003cstrong\u003ePapaya Extract\u003c\/strong\u003e\u003cspan\u003e to gently remove dead cells. Skin conditioning \u003c\/span\u003e\u003cstrong\u003eVitamin B3\u003c\/strong\u003e\u003cspan\u003e and healing \u003c\/span\u003e\u003cstrong\u003eMoringa Extract\u003c\/strong\u003e\u003cspan\u003e all work together to leave the skin feeling clean and refreshed.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e\u003cspan\u003eWater (Aqua), *Helianthus Annuus (Sunflower) Seed Oil, *Cocos Nucifera (Coconut) Oil, *Ricinus Communis (Castor) Seed Oil, , Potassium hydroxide, *Glycerin, *Citric acid, Moringa Oleifera Seed Extract, Carica Papaya (Papaya) Fruit Extract, Spearmint Oil, Eucalyptus Oil, Peppermint Oil, Ginger Oil, Pure Essential Oils and Kaolinite (Rose Clay). *Certified Organic\u003c\/span\u003e\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cspan\u003eMassage onto wet skin, work into a lather, inhale the aroma and rinse. Avoid eye area.\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003ch4\u003e\u003cstrong\u003eJACQ's KEY INGREDIENTS\u003c\/strong\u003e\u003c\/h4\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003ePapaya \u003c\/b\u003ehigh in Vitamin A \u0026amp; E, omega fatty acids, and papain enzymes. Papain enzymes work to gently exfoliate the skin while removing dead skin cells.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eMoringa \u003c\/b\u003eis a rich source of fatty acids great for nourishing the skin. It easily absorbs into skin, a powerful plant that fights inflammation and helps protect against free-radical damage.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Clay\u003c\/strong\u003e easily \u003cspan\u003eabsorbs impurities from the\u003cstrong\u003e \u003c\/strong\u003e\u003c\/span\u003eskin\u003cspan\u003e, such as dirt, makeup, and oils.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"Organic Ingredients, Leaf icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_compact.jpg?v=1517023823\" alt=\"vegan friendly, pig icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\" alt=\"oily\/combination skin, globe icon\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e"}

JACQ's Travel Size Organic Healing Face Cleanser

$ 10.00
JACQ's Vegan, Cruelty-Free Face Cleanser for Oily/Combination Skin PRODUCT INFO INGREDIENTS HOW TO USE Now in a travel size, JACQ's game-changing organic, vegan & cruelty-free face cleanser dissolves dirt, makeup, and impurities on the skin. Creamy in texture, pink in color this face cleanser is formulated with rich Amino Acids, Fruit Enzymes found in Papaya Extract to gently...
JACQ's Skincare Gift Card JACQ's Skincare Gift Card
{"id":4534950723632,"title":"JACQ's Skincare Gift Card","handle":"jacqs-beauty-skincare-gift-card","description":"\u003cp\u003eShopping for someone else but not sure what to give them? Give them the gift of choice with a JACQ's online gift card. Let them decide on what products to add to their new skincare regimen.\u003c\/p\u003e\n\u003cp\u003eGift cards are delivered by email and contain instructions to redeem them at checkout. Our gift cards have no additional processing fees, and never expire.\u003c\/p\u003e","published_at":"2020-05-16T20:37:49-04:00","created_at":"2020-05-06T15:17:10-04:00","vendor":"Jacq's ","type":"Gift Card","tags":["gift card"],"price":2500,"price_min":2500,"price_max":500000,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":31996489138224,"title":"$25.00 USD","option1":"$25.00 USD","option2":null,"option3":null,"sku":"","requires_shipping":false,"taxable":false,"featured_image":null,"available":true,"name":"JACQ's Skincare Gift Card - $25.00 USD","public_title":"$25.00 USD","options":["$25.00 USD"],"price":2500,"weight":0,"compare_at_price":null,"inventory_quantity":-14,"inventory_management":null,"inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]},{"id":31996489170992,"title":"$75.00","option1":"$75.00","option2":null,"option3":null,"sku":"","requires_shipping":false,"taxable":false,"featured_image":null,"available":true,"name":"JACQ's Skincare Gift Card - $75.00","public_title":"$75.00","options":["$75.00"],"price":500000,"weight":0,"compare_at_price":null,"inventory_quantity":-1,"inventory_management":null,"inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]},{"id":31996489203760,"title":"$50.00 USD","option1":"$50.00 USD","option2":null,"option3":null,"sku":"","requires_shipping":false,"taxable":false,"featured_image":null,"available":true,"name":"JACQ's Skincare Gift Card - $50.00 USD","public_title":"$50.00 USD","options":["$50.00 USD"],"price":10000,"weight":0,"compare_at_price":null,"inventory_quantity":-7,"inventory_management":null,"inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]},{"id":31996489236528,"title":"$100.00 USD","option1":"$100.00 USD","option2":null,"option3":null,"sku":"","requires_shipping":false,"taxable":false,"featured_image":null,"available":true,"name":"JACQ's Skincare Gift Card - $100.00 USD","public_title":"$100.00 USD","options":["$100.00 USD"],"price":20000,"weight":0,"compare_at_price":null,"inventory_quantity":0,"inventory_management":null,"inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsGiftcard937x1075.png?v=1657224927","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQ_SGiftcard380x435.png?v=1657224927"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsGiftcard937x1075.png?v=1657224927","options":["Title"],"media":[{"alt":null,"id":22439871283248,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsGiftcard937x1075.png?v=1657224927"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsGiftcard937x1075.png?v=1657224927","width":937},{"alt":null,"id":21947963506736,"position":2,"preview_image":{"aspect_ratio":0.874,"height":435,"width":380,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQ_SGiftcard380x435.png?v=1657224927"},"aspect_ratio":0.874,"height":435,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQ_SGiftcard380x435.png?v=1657224927","width":380}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eShopping for someone else but not sure what to give them? Give them the gift of choice with a JACQ's online gift card. Let them decide on what products to add to their new skincare regimen.\u003c\/p\u003e\n\u003cp\u003eGift cards are delivered by email and contain instructions to redeem them at checkout. Our gift cards have no additional processing fees, and never expire.\u003c\/p\u003e"}

JACQ's Skincare Gift Card

$ 25.00
Shopping for someone else but not sure what to give them? Give them the gift of choice with a JACQ's online gift card. Let them decide on what products to add to their new skincare regimen. Gift cards are delivered by email and contain instructions to redeem them at checkout. Our...
Showing items 1 - 12 of 12
We use cookies to improve our website and your shopping experience.By continuing to browse our site, you are consenting to our use of cookies. Read more about our Privacy Policy