
36 items
New Arrivals
Picked just for you.
Start shopping now.
JACQ's Beta-Acid Acne Treatment JACQ's Beta-Acid Acne Treatment
{"id":10500476675,"title":"JACQ's Beta-Acid Acne Treatment","handle":"the-high-priestess-beauty-booster","description":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-06-09T16:32:27-04:00","vendor":"JACQ'S","type":"Skin Care","tags":[],"price":1900,"price_min":1900,"price_max":1900,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636551619,"title":"1\/2 oz","option1":"1\/2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793009504304,"product_id":10500476675,"position":3,"created_at":"2021-08-09T15:23:56-04:00","updated_at":"2021-08-09T15:49:07-04:00","alt":null,"width":934,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","variant_ids":[40636551619]},"available":true,"name":"JACQ's Beta-Acid Acne Treatment - 1\/2 oz","public_title":"1\/2 oz","options":["1\/2 oz"],"price":1900,"weight":5,"compare_at_price":null,"inventory_quantity":129,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","options":["Size"],"media":[{"alt":null,"id":21058558591024,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058521497648,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"},"aspect_ratio":0.869,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","width":934},{"alt":null,"id":21058521464880,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e"}
{"id":10500480579,"title":"JACQ's PROBIOTIC FACE MASK","handle":"probiotic-face-mask-1","description":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:34-04:00","created_at":"2017-06-09T16:34:13-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","antioxidant","booster","Carrot","emollient","essential oils","Face Mask","face oil","face serum","jackfruit","moisturizer","papaya","protein","skin serum","vitamin E","yucca"],"price":2300,"price_min":2300,"price_max":2300,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636604483,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":29235789692976,"product_id":10500480579,"position":2,"created_at":"2021-12-15T14:18:06-05:00","updated_at":"2022-07-07T16:10:34-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","variant_ids":[40636604483]},"available":true,"name":"JACQ's PROBIOTIC FACE MASK - 2oz","public_title":"2oz","options":["2oz"],"price":2300,"weight":85,"compare_at_price":null,"inventory_quantity":138,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21516283084848,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","options":["Size"],"media":[{"alt":null,"id":22439844610096,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","width":937},{"alt":null,"id":21516283084848,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","width":937},{"alt":null,"id":21058609020976,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634","width":937},{"alt":null,"id":21058585428016,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634","width":937},{"alt":null,"id":21058608988208,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634","width":937},{"alt":null,"id":22439843332144,"position":6,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's Drip Collection Skincare Bundle - Save $10
{"id":10612520899,"title":"JACQ's Drip Collection Skincare Bundle - Save $10","handle":"beauty-boosting-trio","description":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-11T19:04:44-04:00","created_at":"2017-07-09T17:02:19-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","beauty booster","booster","chamomile","face oil","face serum","moringa","protein","protein booster","skin serum","yucca"],"price":6500,"price_min":6500,"price_max":6500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42098492355,"title":"1","option1":"1","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793140805680,"product_id":10612520899,"position":1,"created_at":"2021-08-09T16:36:51-04:00","updated_at":"2021-08-09T16:39:03-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","variant_ids":[42098492355]},"available":true,"name":"JACQ's Drip Collection Skincare Bundle - Save $10 - 1","public_title":"1","options":["1"],"price":6500,"weight":5,"compare_at_price":null,"inventory_quantity":243,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","options":["1 Pack"],"media":[{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's Restorative Face Serum JACQ's Restorative Face Serum
{"id":10636301379,"title":"JACQ's Restorative Face Serum","handle":"jacqs-restorative-face-serum","description":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-07-14T13:01:45-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["amino acids","booster","chamomile","hibiscus","Moringa","plant nutrients","Vitamin A","Vitamin D"],"price":2400,"price_min":2400,"price_max":2400,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42338644867,"title":"1oz","option1":"1oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793074614320,"product_id":10636301379,"position":1,"created_at":"2021-08-09T16:11:09-04:00","updated_at":"2021-08-09T17:44:38-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","variant_ids":[42338644867]},"available":true,"name":"JACQ's Restorative Face Serum - 1oz","public_title":"1oz","options":["1oz"],"price":2400,"weight":5,"compare_at_price":null,"inventory_quantity":33,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","options":["Size"],"media":[{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","width":937},{"alt":null,"id":21058578481200,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","width":937},{"alt":null,"id":21058578513968,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","width":937},{"alt":null,"id":21058578546736,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e"}
JACQ'S Balancing Face Serum JACQ's calm & repair face serum
{"id":10500458115,"title":"JACQ'S Balancing Face Serum","handle":"balancing-face-serum","description":"\u003ch2\u003eVegan-Friendly Face Serum with vitamin boost\u003c\/h2\u003e\n\u003cp\u003e10 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThe root of a \u003cstrong\u003ecarrot contains 89% water.\u003c\/strong\u003e This magical plant is high in \u003cstrong\u003eBeta-carotene, Minerals and Vitamins A, B, C and E\u003c\/strong\u003e. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result is hydrating and supple skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Carthamus (Safflower) Tinctorius, *Rosa Canina (Rosehip) Seed Fruit Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Falcatum (Bupleurum) Root Extract, *Rumex (Yellow Dock) Crispus Extract, *Gentiana Lutea (Gentian) Root Extract, *Aloe Barbadensis Extract, Glycerin, Hippophae Rhamnoides (Sea Buckthorn Berry) CO2 extract, *Pelargonium (Rose Geranium) Graveolens Oil, *Ocimum Basillicum (Basil) Oil, Panthenol, Pure Essential Oils, Tocopherol (non-GM0) and Ferulic Acid. **Certified Organic Ingredient\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eA little goes a long way. Warm one to two drops between hands then gently press onto damp face, neck and decolletage.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e 20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e\n\u003ch3\u003e\n\u003cstrong\u003eKEY \u003c\/strong\u003e\u003cstrong\u003eINGREDIENTS\u003c\/strong\u003e FOR JACQ'S ORGANIC FACE SERUM\u003c\/h3\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003eCarrot\u003c\/strong\u003e is a natural source of beta-carotene, biotin and lycopene. Great for feeding skin antioxidants, cellular reproduction and improving skin texture.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Geranium\u003c\/strong\u003e is an aromatic, floral and sweet essential oil that's an ideal ingredient that \u003cspan\u003epromotes \u003c\/span\u003e\u003cem\u003eskin\u003c\/em\u003e\u003cspan\u003e cell renewal and ideal ingredient for all skin for every skin type.\u003c\/span\u003e \u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eFerulic Acid\u003c\/strong\u003e is a plant-based antioxidant with a rich source of Vitamin C \u0026amp; E. A beautiful ingredient known to naturally brighten skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRosehip Seed Oil\u003c\/strong\u003e is packed with vitamins, antioxidants and essential fatty acids that help combat uneven skin tone and fine lines. \u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-14T12:13:43-04:00","created_at":"2017-06-09T16:24:14-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["antiaging","beta carotene","carrot","face serum","ferulic acid","minerals","rosehip seed oil","vitamin A","Vitamin B","Vitamin C"],"price":1900,"price_min":1900,"price_max":6200,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636383363,"title":"1oz","option1":"1oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S Balancing Face Serum - 1oz","public_title":"1oz","options":["1oz"],"price":6200,"weight":85,"compare_at_price":null,"inventory_quantity":146,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]},{"id":31932473475120,"title":"5g","option1":"5g","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S Balancing Face Serum - 5g","public_title":"5g","options":["5g"],"price":1900,"weight":10,"compare_at_price":null,"inventory_quantity":275,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum2937x1075.png?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumback.jpg?v=1657228018","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs7gbalancingfaceserumfront.jpg?v=1657228018"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018","options":["Size"],"media":[{"alt":null,"id":22440135163952,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum937x1075.png?v=1657228018","width":937},{"alt":"JACQ's calm \u0026 repair face serum","id":7561919660080,"position":2,"preview_image":{"aspect_ratio":0.881,"height":1063,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1657228018"},"aspect_ratio":0.881,"height":1063,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumfront.jpg?v=1657228018","width":937},{"alt":null,"id":22440140668976,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum2937x1075.png?v=1657228018"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsBalancingFaceSerum2937x1075.png?v=1657228018","width":937},{"alt":"JACQ's calm \u0026 repair face serum ingredients label","id":7561919627312,"position":4,"preview_image":{"aspect_ratio":0.873,"height":1070,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumback.jpg?v=1657228018"},"aspect_ratio":0.873,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbalancingfaceserumback.jpg?v=1657228018","width":934},{"alt":"JACQ's Balancing Face Serum ","id":7561935388720,"position":5,"preview_image":{"aspect_ratio":0.869,"height":1073,"width":932,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs7gbalancingfaceserumfront.jpg?v=1657228018"},"aspect_ratio":0.869,"height":1073,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs7gbalancingfaceserumfront.jpg?v=1657228018","width":932}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eVegan-Friendly Face Serum with vitamin boost\u003c\/h2\u003e\n\u003cp\u003e10 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eThe root of a \u003cstrong\u003ecarrot contains 89% water.\u003c\/strong\u003e This magical plant is high in \u003cstrong\u003eBeta-carotene, Minerals and Vitamins A, B, C and E\u003c\/strong\u003e. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result is hydrating and supple skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Carthamus (Safflower) Tinctorius, *Rosa Canina (Rosehip) Seed Fruit Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Falcatum (Bupleurum) Root Extract, *Rumex (Yellow Dock) Crispus Extract, *Gentiana Lutea (Gentian) Root Extract, *Aloe Barbadensis Extract, Glycerin, Hippophae Rhamnoides (Sea Buckthorn Berry) CO2 extract, *Pelargonium (Rose Geranium) Graveolens Oil, *Ocimum Basillicum (Basil) Oil, Panthenol, Pure Essential Oils, Tocopherol (non-GM0) and Ferulic Acid. **Certified Organic Ingredient\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eA little goes a long way. Warm one to two drops between hands then gently press onto damp face, neck and decolletage.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e 20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e\n\u003ch3\u003e\n\u003cstrong\u003eKEY \u003c\/strong\u003e\u003cstrong\u003eINGREDIENTS\u003c\/strong\u003e FOR JACQ'S ORGANIC FACE SERUM\u003c\/h3\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003eCarrot\u003c\/strong\u003e is a natural source of beta-carotene, biotin and lycopene. Great for feeding skin antioxidants, cellular reproduction and improving skin texture.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Geranium\u003c\/strong\u003e is an aromatic, floral and sweet essential oil that's an ideal ingredient that \u003cspan\u003epromotes \u003c\/span\u003e\u003cem\u003eskin\u003c\/em\u003e\u003cspan\u003e cell renewal and ideal ingredient for all skin for every skin type.\u003c\/span\u003e \u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eFerulic Acid\u003c\/strong\u003e is a plant-based antioxidant with a rich source of Vitamin C \u0026amp; E. A beautiful ingredient known to naturally brighten skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRosehip Seed Oil\u003c\/strong\u003e is packed with vitamins, antioxidants and essential fatty acids that help combat uneven skin tone and fine lines. \u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e"}

JACQ'S Balancing Face Serum

$ 19.00
Vegan-Friendly Face Serum with vitamin boost 10 ACTIVE INGREDIENTS PRODUCT INFO INGREDIENTS HOW TO USE The root of a carrot contains 89% water. This magical plant is high in Beta-carotene, Minerals and Vitamins A, B, C and E. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result...
JACQ's Organic Bamboo Charcoal + Roses Detoxifying Bath Bomb Black
{"id":320367689757,"title":"JACQ's Bamboo Charcoal + Roses Detoxifying Bath Bomb","handle":"jacqs-skincare-bamboo-charcoal-bath-bomb","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Detoxifying Organic Bath Bomb with Bamboo Charcoal, Cocoa Butter, \u0026amp; Sea Salt\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT IS IT:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003eFor those that love JACQ's organic Green Smoothie Face Mask aka Clarifying Face Masque and Scrub, we've created a bath bomb that will allow you to indulge and detox. Hand-crafted with activated bamboo charcoal, sea salt to soak away the day and creamy cocoa butter to caress the skin while you soak.\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eBAMBOO CHARCOAL \u0026amp; ROSES BATH BOMB INGREDIENTS:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003eSodium bicarbonate, Citric acid, Theobroma Cacao (Cocoa) Seed Butter*, Magnesium (Sea Salt) Carbonate, Oats, Fragrance, Aloe Barbadensis (Aloe Vera) Extract, Activated Bamboo Charcoal, Rose petals, Pine Needle Essential oil, Ginger Essential oil, Orange Essential Oil and a proprietary blend.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cstrong\u003eHOW TO USE JACQ'S BATH BOMB: \u003c\/strong\u003eFill your bathtub with warm water, drop in the bath bomb and lie back to enjoy the aromatic essential oil blend and sea salt bath.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHO CAN USE IT:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: start;\"\u003e\u003cstrong\u003e\u003cimg style=\"float: none;\" alt=\"all skin types pink icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cem\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free icon, mouse icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MOUSE_small.jpg?v=1499297270\"\u003e\u003c\/em\u003e\u003cimg style=\"float: none;\" alt=\"handmade in small batches, unicorn icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\"\u003e\u003c\/strong\u003e\u003c\/div\u003e","published_at":"2017-11-10T09:32:01-05:00","created_at":"2017-11-27T22:52:00-05:00","vendor":"Jacq's Organics","type":"Bath \u0026 Body","tags":["ALOE","BATH BOMB","Subscription"],"price":700,"price_min":700,"price_max":1800,"available":true,"price_varies":true,"compare_at_price":2000,"compare_at_price_min":2000,"compare_at_price_max":2000,"compare_at_price_varies":false,"variants":[{"id":4771249291293,"title":"Set of 4","option1":"Set of 4","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Bamboo Charcoal + Roses Detoxifying Bath Bomb - Set of 4","public_title":"Set of 4","options":["Set of 4"],"price":1800,"weight":635,"compare_at_price":2000,"inventory_quantity":283,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]},{"id":4771249324061,"title":"Single","option1":"Single","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Bamboo Charcoal + Roses Detoxifying Bath Bomb - Single","public_title":"Single","options":["Single"],"price":700,"weight":168,"compare_at_price":null,"inventory_quantity":98,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_bath_bomb_jacqs_organics.jpg?v=1589145972"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_bath_bomb_jacqs_organics.jpg?v=1589145972","options":["Set"],"media":[{"alt":"JACQ's Organic Bamboo Charcoal + Roses Detoxifying Bath Bomb Black","id":801002651696,"position":1,"preview_image":{"aspect_ratio":1.0,"height":564,"width":564,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_bath_bomb_jacqs_organics.jpg?v=1589145972"},"aspect_ratio":1.0,"height":564,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_bath_bomb_jacqs_organics.jpg?v=1589145972","width":564}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Detoxifying Organic Bath Bomb with Bamboo Charcoal, Cocoa Butter, \u0026amp; Sea Salt\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT IS IT:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003eFor those that love JACQ's organic Green Smoothie Face Mask aka Clarifying Face Masque and Scrub, we've created a bath bomb that will allow you to indulge and detox. Hand-crafted with activated bamboo charcoal, sea salt to soak away the day and creamy cocoa butter to caress the skin while you soak.\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eBAMBOO CHARCOAL \u0026amp; ROSES BATH BOMB INGREDIENTS:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003eSodium bicarbonate, Citric acid, Theobroma Cacao (Cocoa) Seed Butter*, Magnesium (Sea Salt) Carbonate, Oats, Fragrance, Aloe Barbadensis (Aloe Vera) Extract, Activated Bamboo Charcoal, Rose petals, Pine Needle Essential oil, Ginger Essential oil, Orange Essential Oil and a proprietary blend.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cstrong\u003eHOW TO USE JACQ'S BATH BOMB: \u003c\/strong\u003eFill your bathtub with warm water, drop in the bath bomb and lie back to enjoy the aromatic essential oil blend and sea salt bath.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHO CAN USE IT:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: start;\"\u003e\u003cstrong\u003e\u003cimg style=\"float: none;\" alt=\"all skin types pink icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cem\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free icon, mouse icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MOUSE_small.jpg?v=1499297270\"\u003e\u003c\/em\u003e\u003cimg style=\"float: none;\" alt=\"handmade in small batches, unicorn icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\"\u003e\u003c\/strong\u003e\u003c\/div\u003e"}

JACQ's Bamboo Charcoal + Roses Detoxifying Bath Bomb

$ 18.00 $ 20.00
JACQ's Detoxifying Organic Bath Bomb with Bamboo Charcoal, Cocoa Butter, & Sea Salt WHAT IS IT: For those that love JACQ's organic Green Smoothie Face Mask aka Clarifying Face Masque and Scrub, we've created a bath bomb that will allow you to indulge and detox. Hand-crafted with activated bamboo charcoal, sea...
{"id":2156921225264,"title":"JACQ's Beauty Bar Trio + Revitalizing Face Toner","handle":"soap-bar-face-toner-skincare-gift-set","description":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Beauty Bar \u0026amp; Face Toner Organic Skincare Bundle \u003c\/span\u003e\u003c\/h2\u003e\n\u003cp\u003eDiscover and enjoy our beauty bars and our Revitalizing Face Toner. The perfect set to enjoy our hand-crafted bars for yourself, your mom, your wife, your sissy or a co-worker.  \u003c\/p\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"color: #0b5394;\"\u003e\u003cstrong\u003e *Order comes with 2oz beauty bars.\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003eBurdock Root \u003c\/b\u003econtains ingredients known for cleansing the lymphatic system. It's antifungal and antibacterial and an ideal ingredient for regulating oil production in the skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eCoQ10 \u003c\/b\u003eacts as an antioxidant energize your skin and help improves skin elasticity.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eHibiscus\u003c\/strong\u003e is a natural astringent rich in calcium, magnesium, and iron. A cooling and refreshing source of vegetable acids and vitamins A, B6, B12,, 12 C \u0026amp; D. Great for acne and oily combination skin.\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:33-04:00","created_at":"2018-11-24T13:03:12-05:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["beauty bar","burdock root","CoQ10","face toner","gift set","HIBISCUS"],"price":3500,"price_min":3500,"price_max":3500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":21675090477104,"title":"6oz","option1":"6oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15389385359408,"product_id":2156921225264,"position":1,"created_at":"2020-07-16T10:33:02-04:00","updated_at":"2020-08-01T20:47:12-04:00","alt":"3 JACQ'S BEAUTY BARS, 1 BOTTLE HIBISCUS FACE TONER ","width":934,"height":1069,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoapbartrioandfacetoner.jpg?v=1596329232","variant_ids":[21675090477104]},"available":true,"name":"JACQ's Beauty Bar Trio + Revitalizing Face Toner - 6oz","public_title":"6oz","options":["6oz"],"price":3500,"weight":170,"compare_at_price":null,"inventory_quantity":96,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":"3 JACQ'S BEAUTY BARS, 1 BOTTLE HIBISCUS FACE TONER ","id":7562779852848,"position":1,"preview_image":{"aspect_ratio":0.874,"height":1069,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoapbartrioandfacetoner.jpg?v=1596329232"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoapbartrioandfacetoner.jpg?v=1596329232"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoapbartrioandfacetoner.jpg?v=1596329232","options":["Size"],"media":[{"alt":"3 JACQ'S BEAUTY BARS, 1 BOTTLE HIBISCUS FACE TONER ","id":7562779852848,"position":1,"preview_image":{"aspect_ratio":0.874,"height":1069,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoapbartrioandfacetoner.jpg?v=1596329232"},"aspect_ratio":0.874,"height":1069,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqssoapbartrioandfacetoner.jpg?v=1596329232","width":934}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Beauty Bar \u0026amp; Face Toner Organic Skincare Bundle \u003c\/span\u003e\u003c\/h2\u003e\n\u003cp\u003eDiscover and enjoy our beauty bars and our Revitalizing Face Toner. The perfect set to enjoy our hand-crafted bars for yourself, your mom, your wife, your sissy or a co-worker.  \u003c\/p\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"color: #0b5394;\"\u003e\u003cstrong\u003e *Order comes with 2oz beauty bars.\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cstrong\u003eKEY INGREDIENTS\u003c\/strong\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003eBurdock Root \u003c\/b\u003econtains ingredients known for cleansing the lymphatic system. It's antifungal and antibacterial and an ideal ingredient for regulating oil production in the skin.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eCoQ10 \u003c\/b\u003eacts as an antioxidant energize your skin and help improves skin elasticity.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eHibiscus\u003c\/strong\u003e is a natural astringent rich in calcium, magnesium, and iron. A cooling and refreshing source of vegetable acids and vitamins A, B6, B12,, 12 C \u0026amp; D. Great for acne and oily combination skin.\u003c\/li\u003e\n\u003c\/ul\u003e"}

JACQ's Beauty Bar Trio + Revitalizing Face Toner

$ 35.00
JACQ's Beauty Bar & Face Toner Organic Skincare Bundle  Discover and enjoy our beauty bars and our Revitalizing Face Toner. The perfect set to enjoy our hand-crafted bars for yourself, your mom, your wife, your sissy or a co-worker.    *Order comes with 2oz beauty bars. KEY INGREDIENTS Burdock Root contains ingredients...
JACQ's Beta-Acid Acne Treatment JACQ's Beta-Acid Acne Treatment
{"id":10500476675,"title":"JACQ's Beta-Acid Acne Treatment","handle":"the-high-priestess-beauty-booster","description":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-06-09T16:32:27-04:00","vendor":"JACQ'S","type":"Skin Care","tags":[],"price":1900,"price_min":1900,"price_max":1900,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636551619,"title":"1\/2 oz","option1":"1\/2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793009504304,"product_id":10500476675,"position":3,"created_at":"2021-08-09T15:23:56-04:00","updated_at":"2021-08-09T15:49:07-04:00","alt":null,"width":934,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","variant_ids":[40636551619]},"available":true,"name":"JACQ's Beta-Acid Acne Treatment - 1\/2 oz","public_title":"1\/2 oz","options":["1\/2 oz"],"price":1900,"weight":5,"compare_at_price":null,"inventory_quantity":129,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","options":["Size"],"media":[{"alt":null,"id":21058558591024,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058521497648,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"},"aspect_ratio":0.869,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","width":934},{"alt":null,"id":21058521464880,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e"}

JACQ's Beta-Acid Acne Treatment

$ 19.00
JACQ's Fruit Acid & Probiotics Skin Booster  PRODUCT INFO INGREDIENTS HOW TO USE Meet The High Priestess known for her abundance of Fruit Acid & AHA boosting ingredients. With over 20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple...
JACQ's Clarifying Green Smoothie Face Masque and Scrub JACQ's Clarifying Green Smoothie Face Masque and Scrub
{"id":10500475139,"title":"JACQ's Clarifying Green Smoothie Face Masque and Scrub","handle":"jacqs-clarifying-green-smoothie-face-mask-scrub","description":"\u003ch2\u003eJACQ's Green Smoothie Organic Face Mask \u0026amp; Scrub with Charcoal and Sea Salt\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eIt's all about the face mask. JACQ's Green Smoothie Face Masque and Scrub aka Clarifying Mask contains an abundance of Minerals, Botanical Peptides and Rich Clays that work to help get oxygen into skin cells. Our blend of Montmorillonite Clay, Activated Charcoal, and Dead Sea Salt paired together with olive-derived Squalane to draw out impurities while nourishing the skin. Protective Vitamin B3, the natural fruit acids extracts, and our proprietary essential oil blend leaves your skin feeling refreshed, cool and clean.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Rhassoul Clay (Moroccan Lava Clay), *Bentonite Clay, *Zea Mays (Corn) Starch, *Bamboo Activated Charcoal Powder, *Tapioca Starch, *Ascophyllum (Kelp Powder) Nodosum Powder, Calophyllum Inophyllum (Tamanu) Oil. Sodium Chloride (Dead Sea Salt), Niacinamide, Spearmint Oil, Lavender Oil, Rosmarinus Officinalis (Rosemary) Oil, Citrus Limonium (Lemon) Oil, Galangal Extract and Pure Essential Oils. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e45ML - Mix 1\/4 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation. 20ML - Mix 1\/8 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e30 ACTIVE INGREDIENTS IN JACQ'S GREEN SMOOTHIE ORGANIC FACE MASQUE \u0026amp; SCRUB\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e \u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"organic leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\" alt=\"oily\/combination skin, globe icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e","published_at":"2017-07-14T12:13:43-04:00","created_at":"2017-06-09T16:31:39-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["charcoal","essential oils","exfoliate","face scrub","green smoothie face mask","lavender","lemon","Moroccan","organic"],"price":1700,"price_min":1700,"price_max":2700,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636537923,"title":"2 oz","option1":"2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":30101985886256,"product_id":10500475139,"position":1,"created_at":"2022-07-07T16:01:43-04:00","updated_at":"2022-07-07T16:01:49-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","variant_ids":[40636537923]},"available":true,"name":"JACQ's Clarifying Green Smoothie Face Masque and Scrub - 2 oz","public_title":"2 oz","options":["2 oz"],"price":2700,"weight":71,"compare_at_price":null,"inventory_quantity":74,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":22439797260336,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":41905034243,"title":"45 ml","option1":"45 ml","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":30101999845424,"product_id":10500475139,"position":5,"created_at":"2022-07-07T16:05:04-04:00","updated_at":"2022-07-07T16:05:04-04:00","alt":null,"width":935,"height":1070,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304","variant_ids":[41905034243]},"available":true,"name":"JACQ's Clarifying Green Smoothie Face Masque and Scrub - 45 ml","public_title":"45 ml","options":["45 ml"],"price":1700,"weight":168,"compare_at_price":null,"inventory_quantity":129,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":22439813480496,"position":5,"preview_image":{"aspect_ratio":0.874,"height":1070,"width":935,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASKFRONT_9a207218-6f87-441f-a19a-3518ae6259bf.jpg?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask_1.png?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_face_mask_caasi1024X1024.jpg?v=1657224109","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","options":["Size"],"media":[{"alt":null,"id":22439797260336,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareclarifyingfacemasqueandscrub_81fe8951-ec51-4d56-92df-1cfc9cd3f04e.png?v=1657224109","width":937},{"alt":null,"id":7584607666224,"position":2,"preview_image":{"aspect_ratio":0.874,"height":1067,"width":933,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASKFRONT_9a207218-6f87-441f-a19a-3518ae6259bf.jpg?v=1657224109"},"aspect_ratio":0.874,"height":1067,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASKFRONT_9a207218-6f87-441f-a19a-3518ae6259bf.jpg?v=1657224109","width":933},{"alt":null,"id":7584659111984,"position":3,"preview_image":{"aspect_ratio":0.874,"height":435,"width":380,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask_1.png?v=1657224109"},"aspect_ratio":0.874,"height":435,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautymask_1.png?v=1657224109","width":380},{"alt":"Black woman wearing JACQ's green smoothie face mask, drinking tea","id":435672875056,"position":4,"preview_image":{"aspect_ratio":1.0,"height":1024,"width":1024,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_face_mask_caasi1024X1024.jpg?v=1657224109"},"aspect_ratio":1.0,"height":1024,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs_face_mask_caasi1024X1024.jpg?v=1657224109","width":1024},{"alt":null,"id":22439813480496,"position":5,"preview_image":{"aspect_ratio":0.874,"height":1070,"width":935,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304"},"aspect_ratio":0.874,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSCLARIFYINGFACEMASK_937x1075_e881a472-bffa-43b3-b7bc-8f2957b3a18f.jpg?v=1657224304","width":935}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Green Smoothie Organic Face Mask \u0026amp; Scrub with Charcoal and Sea Salt\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eIt's all about the face mask. JACQ's Green Smoothie Face Masque and Scrub aka Clarifying Mask contains an abundance of Minerals, Botanical Peptides and Rich Clays that work to help get oxygen into skin cells. Our blend of Montmorillonite Clay, Activated Charcoal, and Dead Sea Salt paired together with olive-derived Squalane to draw out impurities while nourishing the skin. Protective Vitamin B3, the natural fruit acids extracts, and our proprietary essential oil blend leaves your skin feeling refreshed, cool and clean.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Rhassoul Clay (Moroccan Lava Clay), *Bentonite Clay, *Zea Mays (Corn) Starch, *Bamboo Activated Charcoal Powder, *Tapioca Starch, *Ascophyllum (Kelp Powder) Nodosum Powder, Calophyllum Inophyllum (Tamanu) Oil. Sodium Chloride (Dead Sea Salt), Niacinamide, Spearmint Oil, Lavender Oil, Rosmarinus Officinalis (Rosemary) Oil, Citrus Limonium (Lemon) Oil, Galangal Extract and Pure Essential Oils. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e45ML - Mix 1\/4 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation. 20ML - Mix 1\/8 teaspoon of powder with warm water to form a creamy paste. Apply masque and leave on for 10-15 minutes. Rinse off with cool water in circular motion to activate gentle exfoliation.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e30 ACTIVE INGREDIENTS IN JACQ'S GREEN SMOOTHIE ORGANIC FACE MASQUE \u0026amp; SCRUB\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e \u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"organic leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\" alt=\"oily\/combination skin, globe icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e"}

JACQ's Clarifying Green Smoothie Face Masque and Scrub

$ 17.00
JACQ's Green Smoothie Organic Face Mask & Scrub with Charcoal and Sea Salt PRODUCT INFO INGREDIENTS HOW TO USE It's all about the face mask. JACQ's Green Smoothie Face Masque and Scrub aka Clarifying Mask contains an abundance of Minerals, Botanical Peptides and Rich Clays that work to help get oxygen into skin cells. Our...
JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit
{"id":432966860829,"title":"JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit","handle":"heal-slay-kit-save-10","description":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Best-Selling Heal \u0026amp; Slay Vegan Skincare Trio: Face Cleanser, Toner, and Moisturizer\u003c\/span\u003e\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFORMATION\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHere's the perfect Heal and Slay Vegan Skincare Kit. This cruelty-free beauty kit contains our best sellers. Enjoy this magical trio including the JACQ's Healing Face Cleanser, Revitalizing Face Toner and Nourishing Face Moisturizer all work together to help you slay the day, that meeting, those exams or just to slay selfies. Slaying just got a lot easier!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e","published_at":"2017-07-11T19:04:06-04:00","created_at":"2018-03-08T15:45:59-05:00","vendor":"Jacq's Organics","type":"Gifts","tags":["bundle","coconut","CoQ10","face cleanser","face moisturizer","face toner","heal \u0026 slay kit","moringa","trio","yucca"],"price":7100,"price_min":7100,"price_max":7100,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":32324153049136,"title":"Full size","option1":"Full size","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit - Full size","public_title":"Full size","options":["Full size"],"price":7100,"weight":371,"compare_at_price":null,"inventory_quantity":120,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealandkitboxes.jpg?v=1649449002","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit.png?v=1649449002"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002","options":["Size:"],"media":[{"alt":null,"id":22002511708208,"position":1,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqscleanser_toner_moisturizerhealandslay2048x2048_1.png?v=1649449002","width":2048},{"alt":null,"id":21058647392304,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealandkitboxes.jpg?v=1649449002"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealandkitboxes.jpg?v=1649449002","width":937},{"alt":null,"id":21179951677488,"position":3,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit.png?v=1649449002"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskinproofhealandslaykit.png?v=1649449002","width":2048}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Best-Selling Heal \u0026amp; Slay Vegan Skincare Trio: Face Cleanser, Toner, and Moisturizer\u003c\/span\u003e\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\u003c\/ul\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFORMATION\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHere's the perfect Heal and Slay Vegan Skincare Kit. This cruelty-free beauty kit contains our best sellers. Enjoy this magical trio including the JACQ's Healing Face Cleanser, Revitalizing Face Toner and Nourishing Face Moisturizer all work together to help you slay the day, that meeting, those exams or just to slay selfies. Slaying just got a lot easier!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"Organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"all skin types, pink hand icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, cat icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e"}

JACQ's Cleanser, Toner, Moisturizer Heal + Slay Kit

$ 71.00
JACQ's Best-Selling Heal & Slay Vegan Skincare Trio: Face Cleanser, Toner, and Moisturizer PRODUCT INFORMATION Here's the perfect Heal and Slay Vegan Skincare Kit. This cruelty-free beauty kit contains our best sellers. Enjoy this magical trio including the JACQ's Healing Face Cleanser, Revitalizing Face Toner and Nourishing Face Moisturizer all...
JACQ's Cleansing & Moisturizing Antioxidant Beauty Balm JACQ's Cleansing & Moisturizing Antioxidant Beauty Balm
{"id":10500471235,"title":"JACQ's Cleansing \u0026 Moisturizing Antioxidant Beauty Balm","handle":"cleansing-moisturizing-antioxidant-beauty-balm-2","description":"\u003ch2\u003eJACQ's Organic Balm Cleanser and Moisturizer with Jackfruit \u0026amp; Vanilla Extract\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\n\u003cp\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/p\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eJACQ's organic moisturizing balm starts here. This waterless balm works as a hydrating cleanser and a moisturizer. Enriched with a potent blend of emollients and a powerhouse of Antioxidants including Jackfruit, Rosehip Seed Oil, and Vanilla Extracts. The decadent blend of delicious butter-infused with exotic plant oils melts away makeup, dirt, and debris after a long day or night. Use as a hydrating spa night treatment. \u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Carapa Guianensis (Andiroba) Nut Oil, *Butyrospermum (Shea Butter) Parkii Butter, Theobroma Cacao (Cocoa) Butter, *Vitis Vinifera (Grape) Seed Oil, Rosa Moschata (Rosehip) Seed Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Rumex (Yellow Dock) Crispus Extract, *Chamomilla (Chamomile) Recutita Matricaria Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, *Juniperus (Juniper) Communis Fruit Oil, Calophyllum (Tamanu) Tacamahaca Seed Oil, Pelargonium (Rose Geranium) Graveolens Oil, *Vanilla Planifolia (Vanilla) Fruit Extract, Pure Essential Oils and *Beta (Beet Root) Vulgaris Powder. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTO CLEANSE Warm a small amount in your hands and gently massage onto dry skin. Remove with a warm, damp cloth. TO MOISTURIZE Warm a 1\/2 pea-sized amount in your hands and apply to damp skin. A little goes a long way.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"aging,mature skin, purple balloon icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/AGING_AND_MATURE_ICON_JACQS_SKINCARE_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, bunny icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_compact.jpg?v=1517023823\"\u003e\n\u003c\/div\u003e\n\u003cstyle type=\"text\/css\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e","published_at":"2017-07-14T12:12:34-04:00","created_at":"2017-06-09T16:30:04-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["antioxidant","balm","beauty balm","cleanser","grape seed oil","jackfruit","moisturizer","shea butter","vanilla"],"price":4900,"price_min":4900,"price_max":4900,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636518147,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15389544022064,"product_id":10500471235,"position":2,"created_at":"2020-07-16T11:06:13-04:00","updated_at":"2022-07-07T16:29:59-04:00","alt":null,"width":935,"height":1070,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsantioxidantbeautybalm.jpg?v=1657225799","variant_ids":[40636518147]},"available":true,"name":"JACQ's Cleansing \u0026 Moisturizing Antioxidant Beauty Balm - 2oz","public_title":"2oz","options":["2oz"],"price":4900,"weight":170,"compare_at_price":null,"inventory_quantity":457,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":7562938679344,"position":2,"preview_image":{"aspect_ratio":0.874,"height":1070,"width":935,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsantioxidantbeautybalm.jpg?v=1657225799"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsantioxidantbeautybalmtexture937x1075.png?v=1657225799","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsantioxidantbeautybalm.jpg?v=1657225799","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalm_6208fc5f-6dc5-43cd-bc14-2eb69982f24e.png?v=1657225799","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalmtexture937x1075_7ff8667d-0033-4438-951e-a546938c1695.jpg?v=1657225799","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalmcleanser937x1075.png?v=1657225797"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsantioxidantbeautybalmtexture937x1075.png?v=1657225799","options":["Size"],"media":[{"alt":null,"id":22439947206704,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsantioxidantbeautybalmtexture937x1075.png?v=1657225799"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsantioxidantbeautybalmtexture937x1075.png?v=1657225799","width":937},{"alt":null,"id":7562938679344,"position":2,"preview_image":{"aspect_ratio":0.874,"height":1070,"width":935,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsantioxidantbeautybalm.jpg?v=1657225799"},"aspect_ratio":0.874,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsantioxidantbeautybalm.jpg?v=1657225799","width":935},{"alt":null,"id":7584754335792,"position":3,"preview_image":{"aspect_ratio":0.874,"height":435,"width":380,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalm_6208fc5f-6dc5-43cd-bc14-2eb69982f24e.png?v=1657225799"},"aspect_ratio":0.874,"height":435,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalm_6208fc5f-6dc5-43cd-bc14-2eb69982f24e.png?v=1657225799","width":380},{"alt":null,"id":21058748317744,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalmtexture937x1075_7ff8667d-0033-4438-951e-a546938c1695.jpg?v=1657225799"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalmtexture937x1075_7ff8667d-0033-4438-951e-a546938c1695.jpg?v=1657225799","width":937},{"alt":null,"id":21058752380976,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalmcleanser937x1075.png?v=1657225797"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbeautybalmcleanser937x1075.png?v=1657225797","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Organic Balm Cleanser and Moisturizer with Jackfruit \u0026amp; Vanilla Extract\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\n\u003cp\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/p\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eJACQ's organic moisturizing balm starts here. This waterless balm works as a hydrating cleanser and a moisturizer. Enriched with a potent blend of emollients and a powerhouse of Antioxidants including Jackfruit, Rosehip Seed Oil, and Vanilla Extracts. The decadent blend of delicious butter-infused with exotic plant oils melts away makeup, dirt, and debris after a long day or night. Use as a hydrating spa night treatment. \u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Carapa Guianensis (Andiroba) Nut Oil, *Butyrospermum (Shea Butter) Parkii Butter, Theobroma Cacao (Cocoa) Butter, *Vitis Vinifera (Grape) Seed Oil, Rosa Moschata (Rosehip) Seed Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Rumex (Yellow Dock) Crispus Extract, *Chamomilla (Chamomile) Recutita Matricaria Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, *Juniperus (Juniper) Communis Fruit Oil, Calophyllum (Tamanu) Tacamahaca Seed Oil, Pelargonium (Rose Geranium) Graveolens Oil, *Vanilla Planifolia (Vanilla) Fruit Extract, Pure Essential Oils and *Beta (Beet Root) Vulgaris Powder. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTO CLEANSE Warm a small amount in your hands and gently massage onto dry skin. Remove with a warm, damp cloth. TO MOISTURIZE Warm a 1\/2 pea-sized amount in your hands and apply to damp skin. A little goes a long way.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"vegan friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\"\u003e\u003cimg style=\"float: none;\" alt=\"aging,mature skin, purple balloon icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/AGING_AND_MATURE_ICON_JACQS_SKINCARE_compact.jpg?v=1517023823\"\u003e\u003cimg style=\"float: none;\" alt=\"\"\u003e\u003cimg style=\"float: none;\" alt=\"cruelty-free, bunny icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_compact.jpg?v=1517023823\"\u003e\n\u003c\/div\u003e\n\u003cstyle type=\"text\/css\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e"}

JACQ's Cleansing & Moisturizing Antioxidant Beauty Balm

$ 49.00
JACQ's Organic Balm Cleanser and Moisturizer with Jackfruit & Vanilla Extract PRODUCT INFO INGREDIENTS HOW TO USE JACQ's organic moisturizing balm starts here. This waterless balm works as a hydrating cleanser and a moisturizer. Enriched with a potent blend of emollients and a powerhouse of Antioxidants including Jackfruit, Rosehip Seed Oil, and...
JACQ's Clear Essentials Skincare Kit
{"id":2155883003952,"title":"JACQ's Clear Essentials Skincare Kit","handle":"jacqs-skincare-holiday-gift-set","description":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Skincare Gift Set\u003c\/span\u003e\u003c\/h2\u003e\n\u003cbr\u003eGet healthy, radiant skin with this on the go glow essentials kit. Gently cleanse away dirt without stripping your skin of essential nutrients and moisture with our Healing Face Cleanser followed by our delicious Revitalizing Face Toner and tone your skin. Then hydrate and restore with our Balancing Face Serum packed with omega fatty acids to remedy breakouts and premature aging. Treat yourself to this magical trio. Slaying just got a lot easier!\u003cbr\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"Organic ingredients, leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\" alt=\"cruelty-free, cat icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e","published_at":"2017-07-11T19:04:06-04:00","created_at":"2018-11-23T09:39:24-05:00","vendor":"Jacq's Organics","type":"Gifts","tags":["cleanser","face cleanser","face serum","face toner","gift set","holiday gift set"],"price":7500,"price_min":7500,"price_max":7500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":21665727643696,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Clear Essentials Skincare Kit","public_title":null,"options":["Default Title"],"price":7500,"weight":283,"compare_at_price":null,"inventory_quantity":222,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197","options":["Title"],"media":[{"alt":null,"id":7584341229616,"position":1,"preview_image":{"aspect_ratio":0.87,"height":1071,"width":932,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197"},"aspect_ratio":0.87,"height":1071,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197","width":932}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Skincare Gift Set\u003c\/span\u003e\u003c\/h2\u003e\n\u003cbr\u003eGet healthy, radiant skin with this on the go glow essentials kit. Gently cleanse away dirt without stripping your skin of essential nutrients and moisture with our Healing Face Cleanser followed by our delicious Revitalizing Face Toner and tone your skin. Then hydrate and restore with our Balancing Face Serum packed with omega fatty acids to remedy breakouts and premature aging. Treat yourself to this magical trio. Slaying just got a lot easier!\u003cbr\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"Organic ingredients, leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\" alt=\"cruelty-free, cat icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e"}

JACQ's Clear Essentials Skincare Kit

$ 75.00
JACQ's Skincare Gift Set Get healthy, radiant skin with this on the go glow essentials kit. Gently cleanse away dirt without stripping your skin of essential nutrients and moisture with our Healing Face Cleanser followed by our delicious Revitalizing Face Toner and tone your skin. Then hydrate and restore with our Balancing...
JACQ's - Coconut Kisses Organic Bath Bomb
{"id":280396529693,"title":"JACQ's Coconut Kisses Organic Bath Bomb","handle":"jacqs-organic-coconut-bath-bomb","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Coconut \u0026amp; Oats Organic Bath Bomb\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT IS IT:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003eLove the scent of coconuts? Then you'll love this relaxing and delicious bath bomb. Indulge in a bath filled with coconuts and cocoa butter that renders a sweet and white froth that will leave your skin feeling soft and supple.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT'S IN JACQ's COCONUT KISSES BATH BOMB:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan\u003eSodium bicarbonate, Citric acid, Theobroma Cacao (Cocoa) Seed Butter*, Magnesium (Sea Salt) Carbonate, Coconut Essence, Avena Sativa (\u003cem\u003eOat\u003c\/em\u003e) Kernel.\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan\u003e.\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eHOW TO USE JACQ's COCONUT KISSES BATH BOMBS:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003eFill your bathtub with warm water, drop in one or two bath bombs and get\u003cspan\u003e \u003c\/span\u003ein, lay\u003cspan\u003e \u003c\/span\u003eback and enjoy.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHO IS IT FOR:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: start;\"\u003e\u003cstrong\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_small.jpg?v=1499297299\" alt=\"cruetly-free, bunny icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\" alt=\"handmade in small batches, unicorn icon\" style=\"float: none;\"\u003e\u003c\/strong\u003e\u003c\/div\u003e","published_at":"2018-04-27T09:30:07-04:00","created_at":"2017-11-10T09:46:25-05:00","vendor":"Jacq's Organics","type":"Bath \u0026 Body","tags":["bath bomb","cacao","coconut","sea salt","shea butter"],"price":500,"price_min":500,"price_max":2000,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4031341494301,"title":"Set of 4","option1":"Set of 4","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Coconut Kisses Organic Bath Bomb - Set of 4","public_title":"Set of 4","options":["Set of 4"],"price":2000,"weight":544,"compare_at_price":null,"inventory_quantity":298,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]},{"id":4031341527069,"title":"Single","option1":"Single","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Coconut Kisses Organic Bath Bomb - Single","public_title":"Single","options":["Single"],"price":500,"weight":170,"compare_at_price":null,"inventory_quantity":271,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/coconut_kisses_jacqs_organics_480x480.jpg?v=1590356585"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/coconut_kisses_jacqs_organics_480x480.jpg?v=1590356585","options":["Single"],"media":[{"alt":"JACQ's - Coconut Kisses Organic Bath Bomb","id":801005207600,"position":1,"preview_image":{"aspect_ratio":1.0,"height":480,"width":480,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/coconut_kisses_jacqs_organics_480x480.jpg?v=1590356585"},"aspect_ratio":1.0,"height":480,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/coconut_kisses_jacqs_organics_480x480.jpg?v=1590356585","width":480}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Coconut \u0026amp; Oats Organic Bath Bomb\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT IS IT:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003eLove the scent of coconuts? Then you'll love this relaxing and delicious bath bomb. Indulge in a bath filled with coconuts and cocoa butter that renders a sweet and white froth that will leave your skin feeling soft and supple.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT'S IN JACQ's COCONUT KISSES BATH BOMB:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan\u003eSodium bicarbonate, Citric acid, Theobroma Cacao (Cocoa) Seed Butter*, Magnesium (Sea Salt) Carbonate, Coconut Essence, Avena Sativa (\u003cem\u003eOat\u003c\/em\u003e) Kernel.\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan\u003e.\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eHOW TO USE JACQ's COCONUT KISSES BATH BOMBS:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003eFill your bathtub with warm water, drop in one or two bath bombs and get\u003cspan\u003e \u003c\/span\u003ein, lay\u003cspan\u003e \u003c\/span\u003eback and enjoy.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHO IS IT FOR:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: start;\"\u003e\u003cstrong\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_BUNNY_small.jpg?v=1499297299\" alt=\"cruetly-free, bunny icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\" alt=\"handmade in small batches, unicorn icon\" style=\"float: none;\"\u003e\u003c\/strong\u003e\u003c\/div\u003e"}

JACQ's Coconut Kisses Organic Bath Bomb

$ 5.00
JACQ's Coconut & Oats Organic Bath Bomb WHAT IS IT: Love the scent of coconuts? Then you'll love this relaxing and delicious bath bomb. Indulge in a bath filled with coconuts and cocoa butter that renders a sweet and white froth that will leave your skin feeling soft and supple....
JACQ's organic chocolate & almond bath bomb blue
{"id":280391057437,"title":"JACQ's Cookie Monster Organic Bath Bomb","handle":"jacqs-cookie-monster-cocoa-butter-bath-bomb","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Cocoa Butter Organic Bath Bomb with Almond \u0026amp; Chocolate\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT IS IT:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003eFor those that love sweets, here's a treat just for you. Made with creamy Cocoa butter and delicately scented with almond, chocolate, and sugar. Immerse yourself in a sweet cookie treat.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT'S IN JACQ'S ORGANIC BATH BOMB:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003eSodium bicarbonate, Citric acid, Theobroma Cacao (Cocoa) Seed Butter*, Magnesium (Sea Salt) Carbonate, Oats, Fragrance, Aloe Barbadensis (Aloe Vera) extract and Blue Mica.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cstrong\u003eHOW TO USE JACQ'S ORGANIC BATH BOMB: \u003c\/strong\u003eFill your bathtub with warm water, drop in the organic bath bomb and lie back to enjoy the aromatic essential oil blend and sea salt bath.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHO CAN USE IT:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: start;\"\u003e\u003cstrong\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cem\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MOUSE_small.jpg?v=1499297270\" alt=\"cruelty free, mouse icon\" style=\"float: none;\"\u003e\u003c\/em\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\" alt=\"handmade in small batches, unicorn icon\" style=\"float: none;\"\u003e\u003c\/strong\u003e\u003c\/div\u003e","published_at":"2017-11-10T09:32:01-05:00","created_at":"2017-11-10T09:32:18-05:00","vendor":"Jacq's Organics","type":"Bath \u0026 Body","tags":["almond","ALOE","aloe vera","BATH BOMB","blue","chocolate","cocoa butter","cookie monster","sea salt","Subscription","sugar"],"price":500,"price_min":500,"price_max":2000,"available":true,"price_varies":true,"compare_at_price":700,"compare_at_price_min":700,"compare_at_price_max":700,"compare_at_price_varies":false,"variants":[{"id":4031223824413,"title":"Set of 4","option1":"Set of 4","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Cookie Monster Organic Bath Bomb - Set of 4","public_title":"Set of 4","options":["Set of 4"],"price":2000,"weight":168,"compare_at_price":null,"inventory_quantity":211,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]},{"id":4031223922717,"title":"Single","option1":"Single","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Cookie Monster Organic Bath Bomb - Single","public_title":"Single","options":["Single"],"price":500,"weight":168,"compare_at_price":700,"inventory_quantity":-5,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_bath_bomb_jacqs_organics_480x480_85647dab-c00c-4c7d-b61a-a1b01c55a377.jpg?v=1589745767"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_bath_bomb_jacqs_organics_480x480_85647dab-c00c-4c7d-b61a-a1b01c55a377.jpg?v=1589745767","options":["Set"],"media":[{"alt":"JACQ's organic chocolate \u0026 almond bath bomb blue","id":801005142064,"position":1,"preview_image":{"aspect_ratio":1.0,"height":480,"width":480,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_bath_bomb_jacqs_organics_480x480_85647dab-c00c-4c7d-b61a-a1b01c55a377.jpg?v=1589745767"},"aspect_ratio":1.0,"height":480,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/charcoal_bath_bomb_jacqs_organics_480x480_85647dab-c00c-4c7d-b61a-a1b01c55a377.jpg?v=1589745767","width":480}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Cocoa Butter Organic Bath Bomb with Almond \u0026amp; Chocolate\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT IS IT:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003eFor those that love sweets, here's a treat just for you. Made with creamy Cocoa butter and delicately scented with almond, chocolate, and sugar. Immerse yourself in a sweet cookie treat.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHAT'S IN JACQ'S ORGANIC BATH BOMB:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003eSodium bicarbonate, Citric acid, Theobroma Cacao (Cocoa) Seed Butter*, Magnesium (Sea Salt) Carbonate, Oats, Fragrance, Aloe Barbadensis (Aloe Vera) extract and Blue Mica.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cstrong\u003eHOW TO USE JACQ'S ORGANIC BATH BOMB: \u003c\/strong\u003eFill your bathtub with warm water, drop in the organic bath bomb and lie back to enjoy the aromatic essential oil blend and sea salt bath.\u003c\/div\u003e\n\u003cdiv\u003e.\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003eWHO CAN USE IT:\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: start;\"\u003e\u003cstrong\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cem\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MOUSE_small.jpg?v=1499297270\" alt=\"cruelty free, mouse icon\" style=\"float: none;\"\u003e\u003c\/em\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/SMALL_BATCHES_JACQS_ORGANICS_small.jpg?v=1510315561\" alt=\"handmade in small batches, unicorn icon\" style=\"float: none;\"\u003e\u003c\/strong\u003e\u003c\/div\u003e"}

JACQ's Cookie Monster Organic Bath Bomb

$ 5.00 $ 7.00
JACQ's Cocoa Butter Organic Bath Bomb with Almond & Chocolate WHAT IS IT: For those that love sweets, here's a treat just for you. Made with creamy Cocoa butter and delicately scented with almond, chocolate, and sugar. Immerse yourself in a sweet cookie treat. . WHAT'S IN JACQ'S ORGANIC BATH...
JACQ's Organic Dark Chocolate Coffee Bath Bomb, white & beige color
{"id":3387518787,"title":"JACQ's Dark Chocolate Coffee Bath Bomb","handle":"chocolate-coffee-bath-bomb","description":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Organic Dark Chocolate Bath Bomb for Inflammation\u003c\/span\u003e\u003c\/h2\u003e\n\u003cbr\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003eDESCRIPTION\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003e\n\u003cul\u003e\n\u003cli\u003eOrganic \u003cstrong\u003edark\u003c\/strong\u003e \u003cstrong\u003echocolate\u003c\/strong\u003e is a powerful food source that has a lot of skin healing properties including inflammation reduction and leaves skin feeling soft and smooth.\u003c\/li\u003e\n\u003cli\u003eThe highly caffeinated \u003cstrong\u003ecoffee\u003c\/strong\u003e bean is no stranger to beauty. The 100% natural Coffee used in JACQ's organic bath bombs works to reduce inflammation and improve blood circulation.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003eSodium bicarbonate, Citric acid, Theobroma Cacao (Cocoa) Seed Butter*, Magnesium (Sea Salt) Carbonate, Grounded coffee, and grounded chocolate.\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eFill your bathtub with warm water, drop in one or two JACQ's organic bath bombs and get in, lay back and enjoy.\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2018-04-27T09:30:03-04:00","created_at":"2015-10-30T02:50:06-04:00","vendor":"Jacq's Organics ","type":"Bath \u0026 Body","tags":["Bath \u0026 Body","BATH BOMB","cacao","circulation","citric acid","coffee","dark chocolate","inflammation","sea salt"],"price":700,"price_min":700,"price_max":2000,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":9868652995,"title":"Set of 4","option1":"Set of 4","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Dark Chocolate Coffee Bath Bomb - Set of 4","public_title":"Set of 4","options":["Set of 4"],"price":2000,"weight":57,"compare_at_price":null,"inventory_quantity":14,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]},{"id":29239735235,"title":"Single","option1":"Single","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Dark Chocolate Coffee Bath Bomb - Single","public_title":"Single","options":["Single"],"price":700,"weight":57,"compare_at_price":null,"inventory_quantity":207,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/Chocolate_Coffee_1024x1024_b41c5849-1d7c-4147-abe1-742675e8c61a.jpg?v=1589146203"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/Chocolate_Coffee_1024x1024_b41c5849-1d7c-4147-abe1-742675e8c61a.jpg?v=1589146203","options":["Size"],"media":[{"alt":"JACQ's Organic Dark Chocolate Coffee Bath Bomb, white \u0026 beige color","id":92215148592,"position":1,"preview_image":{"aspect_ratio":1.0,"height":480,"width":480,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Chocolate_Coffee_1024x1024_b41c5849-1d7c-4147-abe1-742675e8c61a.jpg?v=1589146203"},"aspect_ratio":1.0,"height":480,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Chocolate_Coffee_1024x1024_b41c5849-1d7c-4147-abe1-742675e8c61a.jpg?v=1589146203","width":480}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Organic Dark Chocolate Bath Bomb for Inflammation\u003c\/span\u003e\u003c\/h2\u003e\n\u003cbr\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003eDESCRIPTION\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003e\n\u003cul\u003e\n\u003cli\u003eOrganic \u003cstrong\u003edark\u003c\/strong\u003e \u003cstrong\u003echocolate\u003c\/strong\u003e is a powerful food source that has a lot of skin healing properties including inflammation reduction and leaves skin feeling soft and smooth.\u003c\/li\u003e\n\u003cli\u003eThe highly caffeinated \u003cstrong\u003ecoffee\u003c\/strong\u003e bean is no stranger to beauty. The 100% natural Coffee used in JACQ's organic bath bombs works to reduce inflammation and improve blood circulation.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003eSodium bicarbonate, Citric acid, Theobroma Cacao (Cocoa) Seed Butter*, Magnesium (Sea Salt) Carbonate, Grounded coffee, and grounded chocolate.\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eFill your bathtub with warm water, drop in one or two JACQ's organic bath bombs and get in, lay back and enjoy.\u003c\/li\u003e\n\u003c\/ul\u003e"}

JACQ's Dark Chocolate Coffee Bath Bomb

$ 7.00
JACQ's Organic Dark Chocolate Bath Bomb for Inflammation DESCRIPTION INGREDIENTS HOW TO Organic dark chocolate is a powerful food source that has a lot of skin healing properties including inflammation reduction and leaves skin feeling soft and smooth. The highly caffeinated coffee bean is no stranger to beauty. The 100% natural...
JACQ's Detox and Glow Vegan Skincare Kit
{"id":10620877315,"title":"JACQ's Detox and Glow Vegan Skincare Kit","handle":"jacqs-detox-and-glow-vegan-skincare-kit","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eHere's your weekend detox and glow set. \u003c\/strong\u003eFor the days or night's when you just want to put on a mask and put your hair in a bun. \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/healing-face-cleanser-2\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Healing Face Cleanser\"\u003eHealing Face Cleanser\u003c\/a\u003e refreshes and purifies the skin with \u003cstrong\u003epeppermint, rosemary and papaya extract\u003c\/strong\u003e. While the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/clarifying-masque-and-scrub\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Clarifying Masque \u0026amp; Face Scrub\"\u003eClarifying Face Masque \u0026amp; Scrub \u003c\/a\u003edetoxifies your skin and feeds it \u003cstrong\u003eminerals and active ingredients\u003c\/strong\u003e. Spritz the cooling and refreshing\u003ca href=\"https:\/\/\/collections\/skin-care\/products\/revitalizing-face-toner-1\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's revitalizing toner \"\u003e Revitalizing Face Toner\u003c\/a\u003e enriched with \u003cstrong\u003eCoQ10\u003c\/strong\u003e to help minimize the appearance of pores then restore your glow with the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/antioxidant-infused-beauty-balm\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Moisturizing Antioxidant Beauty Balm\"\u003eMoisturizing Antioxidant Beauty Balm \u003c\/a\u003ethat nourishes and replenishes.\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"Vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" style=\"float: none;\"\u003e\u003cimg alt=\"Cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e","published_at":"2017-07-11T19:04:05-04:00","created_at":"2017-07-11T05:23:22-04:00","vendor":"Jacq's Organics ","type":"Gifts","tags":["beauty balm","bundle","cleanser","Face Mask","face scrub","face toner","gift set","skincare"],"price":12800,"price_min":12800,"price_max":12800,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42178827523,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Detox and Glow Vegan Skincare Kit","public_title":null,"options":["Default Title"],"price":12800,"weight":454,"compare_at_price":null,"inventory_quantity":215,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsDetoxandGlowKit937x1075.png?v=1657227028"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsDetoxandGlowKit937x1075.png?v=1657227028","options":["Title"],"media":[{"alt":null,"id":22440058716208,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsDetoxandGlowKit937x1075.png?v=1657227028"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsDetoxandGlowKit937x1075.png?v=1657227028","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eHere's your weekend detox and glow set. \u003c\/strong\u003eFor the days or night's when you just want to put on a mask and put your hair in a bun. \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/healing-face-cleanser-2\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Healing Face Cleanser\"\u003eHealing Face Cleanser\u003c\/a\u003e refreshes and purifies the skin with \u003cstrong\u003epeppermint, rosemary and papaya extract\u003c\/strong\u003e. While the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/clarifying-masque-and-scrub\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Clarifying Masque \u0026amp; Face Scrub\"\u003eClarifying Face Masque \u0026amp; Scrub \u003c\/a\u003edetoxifies your skin and feeds it \u003cstrong\u003eminerals and active ingredients\u003c\/strong\u003e. Spritz the cooling and refreshing\u003ca href=\"https:\/\/\/collections\/skin-care\/products\/revitalizing-face-toner-1\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's revitalizing toner \"\u003e Revitalizing Face Toner\u003c\/a\u003e enriched with \u003cstrong\u003eCoQ10\u003c\/strong\u003e to help minimize the appearance of pores then restore your glow with the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/antioxidant-infused-beauty-balm\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Moisturizing Antioxidant Beauty Balm\"\u003eMoisturizing Antioxidant Beauty Balm \u003c\/a\u003ethat nourishes and replenishes.\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"Vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" style=\"float: none;\"\u003e\u003cimg alt=\"Cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e"}

JACQ's Detox and Glow Vegan Skincare Kit

$ 128.00
JACQ's Vegan-Friendly Skincare Kit for All Skin Types WHAT IT IS: Here's your weekend detox and glow set. For the days or night's when you just want to put on a mask and put your hair in a bun. Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary...
Showing items 1 - 12 of 36
We use cookies to improve our website and your shopping experience.By continuing to browse our site, you are consenting to our use of cookies. Read more about our Privacy Policy