Normal Skin

4 items
New Arrivals
Picked just for you.
Start shopping now.
JACQ's Beta-Acid Acne Treatment JACQ's Beta-Acid Acne Treatment
{"id":10500476675,"title":"JACQ's Beta-Acid Acne Treatment","handle":"the-high-priestess-beauty-booster","description":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-06-09T16:32:27-04:00","vendor":"JACQ'S","type":"Skin Care","tags":[],"price":1900,"price_min":1900,"price_max":1900,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636551619,"title":"1\/2 oz","option1":"1\/2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793009504304,"product_id":10500476675,"position":3,"created_at":"2021-08-09T15:23:56-04:00","updated_at":"2021-08-09T15:49:07-04:00","alt":null,"width":934,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","variant_ids":[40636551619]},"available":true,"name":"JACQ's Beta-Acid Acne Treatment - 1\/2 oz","public_title":"1\/2 oz","options":["1\/2 oz"],"price":1900,"weight":5,"compare_at_price":null,"inventory_quantity":131,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","options":["Size"],"media":[{"alt":null,"id":21058558591024,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058521497648,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","width":937},{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547"},"aspect_ratio":0.869,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","width":934},{"alt":null,"id":21058521464880,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e"}
{"id":10500480579,"title":"JACQ's PROBIOTIC FACE MASK","handle":"probiotic-face-mask-1","description":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:34-04:00","created_at":"2017-06-09T16:34:13-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","antioxidant","booster","Carrot","emollient","essential oils","Face Mask","face oil","face serum","jackfruit","moisturizer","papaya","protein","skin serum","vitamin E","yucca"],"price":2300,"price_min":2300,"price_max":2300,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636604483,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":29235789692976,"product_id":10500480579,"position":2,"created_at":"2021-12-15T14:18:06-05:00","updated_at":"2022-07-07T16:10:34-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","variant_ids":[40636604483]},"available":true,"name":"JACQ's PROBIOTIC FACE MASK - 2oz","public_title":"2oz","options":["2oz"],"price":2300,"weight":85,"compare_at_price":null,"inventory_quantity":143,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21516283084848,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634","\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","options":["Size"],"media":[{"alt":null,"id":22439844610096,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075_1.png?v=1657224634","width":937},{"alt":null,"id":21516283084848,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskfr937x1075.png?v=1657224634","width":937},{"alt":null,"id":21058609020976,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1657224634","width":937},{"alt":null,"id":21058585428016,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1657224634","width":937},{"alt":null,"id":21058608988208,"position":5,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1657224634","width":937},{"alt":null,"id":22439843332144,"position":6,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsProbioticFaceMask937x1075.png?v=1657224634","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's Drip Collection Skincare Bundle - Save $10
{"id":10612520899,"title":"JACQ's Drip Collection Skincare Bundle - Save $10","handle":"beauty-boosting-trio","description":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-11T19:04:44-04:00","created_at":"2017-07-09T17:02:19-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","beauty booster","booster","chamomile","face oil","face serum","moringa","protein","protein booster","skin serum","yucca"],"price":6500,"price_min":6500,"price_max":6500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42098492355,"title":"1","option1":"1","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793140805680,"product_id":10612520899,"position":1,"created_at":"2021-08-09T16:36:51-04:00","updated_at":"2021-08-09T16:39:03-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","variant_ids":[42098492355]},"available":true,"name":"JACQ's Drip Collection Skincare Bundle - Save $10 - 1","public_title":"1","options":["1"],"price":6500,"weight":5,"compare_at_price":null,"inventory_quantity":244,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","options":["1 Pack"],"media":[{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's Restorative Face Serum JACQ's Restorative Face Serum
{"id":10636301379,"title":"JACQ's Restorative Face Serum","handle":"jacqs-restorative-face-serum","description":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-07-14T13:01:45-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["amino acids","booster","chamomile","hibiscus","Moringa","plant nutrients","Vitamin A","Vitamin D"],"price":2400,"price_min":2400,"price_max":2400,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42338644867,"title":"1oz","option1":"1oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793074614320,"product_id":10636301379,"position":1,"created_at":"2021-08-09T16:11:09-04:00","updated_at":"2021-08-09T17:44:38-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","variant_ids":[42338644867]},"available":true,"name":"JACQ's Restorative Face Serum - 1oz","public_title":"1oz","options":["1oz"],"price":2400,"weight":5,"compare_at_price":null,"inventory_quantity":37,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","options":["Size"],"media":[{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","width":937},{"alt":null,"id":21058578481200,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","width":937},{"alt":null,"id":21058578513968,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","width":937},{"alt":null,"id":21058578546736,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e"}
JACQ's Detox and Glow Vegan Skincare Kit
{"id":10620877315,"title":"JACQ's Detox and Glow Vegan Skincare Kit","handle":"jacqs-detox-and-glow-vegan-skincare-kit","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eHere's your weekend detox and glow set. \u003c\/strong\u003eFor the days or night's when you just want to put on a mask and put your hair in a bun. \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/healing-face-cleanser-2\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Healing Face Cleanser\"\u003eHealing Face Cleanser\u003c\/a\u003e refreshes and purifies the skin with \u003cstrong\u003epeppermint, rosemary and papaya extract\u003c\/strong\u003e. While the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/clarifying-masque-and-scrub\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Clarifying Masque \u0026amp; Face Scrub\"\u003eClarifying Face Masque \u0026amp; Scrub \u003c\/a\u003edetoxifies your skin and feeds it \u003cstrong\u003eminerals and active ingredients\u003c\/strong\u003e. Spritz the cooling and refreshing\u003ca href=\"https:\/\/\/collections\/skin-care\/products\/revitalizing-face-toner-1\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's revitalizing toner \"\u003e Revitalizing Face Toner\u003c\/a\u003e enriched with \u003cstrong\u003eCoQ10\u003c\/strong\u003e to help minimize the appearance of pores then restore your glow with the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/antioxidant-infused-beauty-balm\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Moisturizing Antioxidant Beauty Balm\"\u003eMoisturizing Antioxidant Beauty Balm \u003c\/a\u003ethat nourishes and replenishes.\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"Vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" style=\"float: none;\"\u003e\u003cimg alt=\"Cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e","published_at":"2017-07-11T19:04:05-04:00","created_at":"2017-07-11T05:23:22-04:00","vendor":"Jacq's Organics ","type":"Gifts","tags":["beauty balm","bundle","cleanser","Face Mask","face scrub","face toner","gift set","skincare"],"price":12800,"price_min":12800,"price_max":12800,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42178827523,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Detox and Glow Vegan Skincare Kit","public_title":null,"options":["Default Title"],"price":12800,"weight":454,"compare_at_price":null,"inventory_quantity":216,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsDetoxandGlowKit937x1075.png?v=1657227028"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsDetoxandGlowKit937x1075.png?v=1657227028","options":["Title"],"media":[{"alt":null,"id":22440058716208,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsDetoxandGlowKit937x1075.png?v=1657227028"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JacqsDetoxandGlowKit937x1075.png?v=1657227028","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eHere's your weekend detox and glow set. \u003c\/strong\u003eFor the days or night's when you just want to put on a mask and put your hair in a bun. \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/healing-face-cleanser-2\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Healing Face Cleanser\"\u003eHealing Face Cleanser\u003c\/a\u003e refreshes and purifies the skin with \u003cstrong\u003epeppermint, rosemary and papaya extract\u003c\/strong\u003e. While the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/clarifying-masque-and-scrub\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Clarifying Masque \u0026amp; Face Scrub\"\u003eClarifying Face Masque \u0026amp; Scrub \u003c\/a\u003edetoxifies your skin and feeds it \u003cstrong\u003eminerals and active ingredients\u003c\/strong\u003e. Spritz the cooling and refreshing\u003ca href=\"https:\/\/\/collections\/skin-care\/products\/revitalizing-face-toner-1\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's revitalizing toner \"\u003e Revitalizing Face Toner\u003c\/a\u003e enriched with \u003cstrong\u003eCoQ10\u003c\/strong\u003e to help minimize the appearance of pores then restore your glow with the \u003ca href=\"https:\/\/\/collections\/skin-care\/products\/antioxidant-infused-beauty-balm\" target=\"_blank\" rel=\"noopener noreferrer\" title=\"Shop JACQ's Moisturizing Antioxidant Beauty Balm\"\u003eMoisturizing Antioxidant Beauty Balm \u003c\/a\u003ethat nourishes and replenishes.\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"Vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" style=\"float: none;\"\u003e\u003cimg alt=\"Cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e"}

JACQ's Detox and Glow Vegan Skincare Kit

$ 128.00
JACQ's Vegan-Friendly Skincare Kit for All Skin Types WHAT IT IS: Here's your weekend detox and glow set. For the days or night's when you just want to put on a mask and put your hair in a bun. Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary...
JACQ's Clear Essentials Skincare Kit
{"id":2155883003952,"title":"JACQ's Clear Essentials Skincare Kit","handle":"jacqs-skincare-holiday-gift-set","description":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Skincare Gift Set\u003c\/span\u003e\u003c\/h2\u003e\n\u003cbr\u003eGet healthy, radiant skin with this on the go glow essentials kit. Gently cleanse away dirt without stripping your skin of essential nutrients and moisture with our Healing Face Cleanser followed by our delicious Revitalizing Face Toner and tone your skin. Then hydrate and restore with our Balancing Face Serum packed with omega fatty acids to remedy breakouts and premature aging. Treat yourself to this magical trio. Slaying just got a lot easier!\u003cbr\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"Organic ingredients, leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\" alt=\"cruelty-free, cat icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e","published_at":"2017-07-11T19:04:06-04:00","created_at":"2018-11-23T09:39:24-05:00","vendor":"Jacq's Organics","type":"Gifts","tags":["cleanser","face cleanser","face serum","face toner","gift set","holiday gift set"],"price":7500,"price_min":7500,"price_max":7500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":21665727643696,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Clear Essentials Skincare Kit","public_title":null,"options":["Default Title"],"price":7500,"weight":283,"compare_at_price":null,"inventory_quantity":222,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197","options":["Title"],"media":[{"alt":null,"id":7584341229616,"position":1,"preview_image":{"aspect_ratio":0.87,"height":1071,"width":932,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197"},"aspect_ratio":0.87,"height":1071,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsessentialskincarekit.jpg?v=1595424197","width":932}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cspan style=\"font-family: -apple-system, BlinkMacSystemFont, 'San Francisco', 'Segoe UI', Roboto, 'Helvetica Neue', sans-serif; font-size: 1.4em;\"\u003eJACQ's Skincare Gift Set\u003c\/span\u003e\u003c\/h2\u003e\n\u003cbr\u003eGet healthy, radiant skin with this on the go glow essentials kit. Gently cleanse away dirt without stripping your skin of essential nutrients and moisture with our Healing Face Cleanser followed by our delicious Revitalizing Face Toner and tone your skin. Then hydrate and restore with our Balancing Face Serum packed with omega fatty acids to remedy breakouts and premature aging. Treat yourself to this magical trio. Slaying just got a lot easier!\u003cbr\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"Organic ingredients, leaf icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_688e91dd-4261-4ab1-ab99-7c884629896a_compact.jpg?v=1519958861\" alt=\"vegan-friendly, bird icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_KITTY_9fba91a9-90e4-4cf0-a9e7-537e507bbaa4_compact.jpg?v=1519958929\" alt=\"cruelty-free, cat icon\" style=\"float: none;\"\u003e\n\u003c\/div\u003e\n\u003cp\u003ePrecaution: FOR EXTERNAL USE ONLY. Avoid contact with eyes.\u003c\/p\u003e"}

JACQ's Clear Essentials Skincare Kit

$ 75.00
JACQ's Skincare Gift Set Get healthy, radiant skin with this on the go glow essentials kit. Gently cleanse away dirt without stripping your skin of essential nutrients and moisture with our Healing Face Cleanser followed by our delicious Revitalizing Face Toner and tone your skin. Then hydrate and restore with our Balancing...
{"id":6547807830064,"title":"JACQ'S EASY PEASEY SKINCARE SLAY KIT","handle":"jacqs-easy-peasey-skincare-slay-kit","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eGet your self-care on, sis!  Indulge and enjoy a session of masking, messy bun, and a delicious moisturizer, lol.  The Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary, and papaya extract. While the Clarifying Face Masque \u0026amp; Scrub detoxifies your skin and feeds it minerals and active ingredients. Bring it all together with our delicious peptide-packed Nourishing Face Moisturizer to seal in all the moisture and restore that glow! Perfect for the skincare junkie and the lazy skincare queens.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"all skin types, pink icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cstrong\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" alt=\"Vegan-friendly, bird icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" alt=\"Cruelty-free, monkey icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" alt=\"organic ingredients, leaf icon\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e","published_at":"2021-03-17T16:31:19-04:00","created_at":"2021-03-17T16:01:37-04:00","vendor":"Jacq's Organics","type":"Gifts","tags":["beauty balm","bundle","cleanser","Face Mask","face scrub","face toner","gift set","skincare"],"price":7000,"price_min":7000,"price_max":7000,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39334934806576,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S EASY PEASEY SKINCARE SLAY KIT","public_title":null,"options":["Default Title"],"price":7000,"weight":454,"compare_at_price":null,"inventory_quantity":67,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareeasypeasy2048x2048.png?v=1649449639","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealingfacecleanserandclarifyingfacemask937x1075.jpg?v=1649449639","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075.jpg?v=1649449639"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareeasypeasy2048x2048.png?v=1649449639","options":["Title"],"media":[{"alt":null,"id":22002555289648,"position":1,"preview_image":{"aspect_ratio":1.0,"height":2048,"width":2048,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareeasypeasy2048x2048.png?v=1649449639"},"aspect_ratio":1.0,"height":2048,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsskincareeasypeasy2048x2048.png?v=1649449639","width":2048},{"alt":null,"id":21058657419312,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealingfacecleanserandclarifyingfacemask937x1075.jpg?v=1649449639"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealingfacecleanserandclarifyingfacemask937x1075.jpg?v=1649449639","width":937},{"alt":null,"id":21058657517616,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075.jpg?v=1649449639"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075.jpg?v=1649449639","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eGet your self-care on, sis!  Indulge and enjoy a session of masking, messy bun, and a delicious moisturizer, lol.  The Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary, and papaya extract. While the Clarifying Face Masque \u0026amp; Scrub detoxifies your skin and feeds it minerals and active ingredients. Bring it all together with our delicious peptide-packed Nourishing Face Moisturizer to seal in all the moisture and restore that glow! Perfect for the skincare junkie and the lazy skincare queens.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"all skin types, pink icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cstrong\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" alt=\"Vegan-friendly, bird icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" alt=\"Cruelty-free, monkey icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" alt=\"organic ingredients, leaf icon\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e"}


$ 70.00
JACQ's Vegan-Friendly Skincare Kit for All Skin Types WHAT IT IS: Get your self-care on, sis!  Indulge and enjoy a session of masking, messy bun, and a delicious moisturizer, lol.  The Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary, and papaya extract. While the Clarifying Face Masque...
JACQ's Dewy AF Vegan Skincare Kit
{"id":6564384309296,"title":"JACQ's Dewy AF Vegan Skincare Kit","handle":"jacqs-dewy-af-vegan-skincare-kit","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e Meet the newest set on the block. Our Nourishing Face Moisturizer and Hibiscus \u0026amp; Carrot Beauty Bar gently cleanse your face to treating acne breakouts and hydrate and treating bumpy skin and dryness\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"Vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" style=\"float: none;\"\u003e\u003cimg alt=\"Cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box.\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e","published_at":"2021-04-09T18:59:59-04:00","created_at":"2021-04-09T18:58:00-04:00","vendor":"Jacq's Organics","type":"Gifts","tags":["beauty balm","bundle","cleanser","Face Mask","face scrub","face toner","gift set","skincare"],"price":3500,"price_min":3500,"price_max":3500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39431386660912,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Dewy AF Vegan Skincare Kit","public_title":null,"options":["Default Title"],"price":3500,"weight":170,"compare_at_price":null,"inventory_quantity":19,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JACQScarrotmoisturizer.jpg?v=1618009165"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JACQScarrotmoisturizer.jpg?v=1618009165","options":["Title"],"media":[{"alt":null,"id":20473022087216,"position":1,"preview_image":{"aspect_ratio":0.878,"height":1067,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQScarrotmoisturizer.jpg?v=1618009165"},"aspect_ratio":0.878,"height":1067,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQScarrotmoisturizer.jpg?v=1618009165","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e Meet the newest set on the block. Our Nourishing Face Moisturizer and Hibiscus \u0026amp; Carrot Beauty Bar gently cleanse your face to treating acne breakouts and hydrate and treating bumpy skin and dryness\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"Vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" style=\"float: none;\"\u003e\u003cimg alt=\"Cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box.\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e"}

JACQ's Dewy AF Vegan Skincare Kit

$ 35.00
JACQ's Vegan-Friendly Skincare Kit for All Skin Types WHAT IT IS:  Meet the newest set on the block. Our Nourishing Face Moisturizer and Hibiscus & Carrot Beauty Bar gently cleanse your face to treating acne breakouts and hydrate and treating bumpy skin and dryness JACQ's DETOX & GLOW VEGAN SKINCARE...
Showing items 1 - 4 of 4
We use cookies to improve our website and your shopping experience.By continuing to browse our site, you are consenting to our use of cookies. Read more about our Privacy Policy