Blemish-Prone Skin

17 items
New Arrivals
Picked just for you.
Start shopping now.
JACQ's Beta-Acid Acne Treatment JACQ's Beta-Acid Acne Treatment
{"id":10500476675,"title":"JACQ's Beta-Acid Acne Treatment","handle":"the-high-priestess-beauty-booster","description":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-06-09T16:32:27-04:00","vendor":"JACQ'S","type":"Skin Care","tags":[],"price":1900,"price_min":1900,"price_max":1900,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636551619,"title":"1\/2 oz","option1":"1\/2 oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793009504304,"product_id":10500476675,"position":3,"created_at":"2021-08-09T15:23:56-04:00","updated_at":"2021-08-09T15:49:07-04:00","alt":null,"width":934,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","variant_ids":[40636551619]},"available":true,"name":"JACQ's Beta-Acid Acne Treatment - 1\/2 oz","public_title":"1\/2 oz","options":["1\/2 oz"],"price":1900,"weight":5,"compare_at_price":null,"inventory_quantity":182,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628537036"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628538547","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628538547"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538547","options":["Size"],"media":[{"alt":null,"id":21058558591024,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538522"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment2934x1075.jpg?v=1628538522","width":937},{"alt":null,"id":21058521497648,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628537331"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentfront934x1075.jpg?v=1628537331","width":937},{"alt":null,"id":21058511765552,"position":3,"preview_image":{"aspect_ratio":0.869,"height":1075,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628537036"},"aspect_ratio":0.869,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatment934x1075.jpg?v=1628537036","width":934},{"alt":null,"id":21058521464880,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628537329"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsbetaacidtreatmentback934x1075.jpg?v=1628537329","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fruit Acid \u0026amp; Probiotics Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet The High Priestess known for her\u003cstrong\u003e abundance of Fruit Acid \u0026amp; AHA\u003c\/strong\u003e boosting ingredients. With over \u003cstrong\u003e20 Active Ingredients, this booster contains transformative plant-based probiotics, naturally-derived Fruit Acid and AHA extract from Papaya, Lemon, Grape, and Pineapple that help remedy blemishes, naturally lighten skin and kick butt.\u003c\/strong\u003e With a boost from\u003cstrong\u003e Squalane, an array of phytonutrients\u003c\/strong\u003e and an extra boost of Vitamin B5 this power squad helps restore radiance, conditions and heals.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e*Aloe Barbadensis Leaf Juice, *Vegetable Glycerin, Leucidal Bioferment (Radish Root) Extract, *Vitis Vinifera (Grape) Seed Oil, Xatham Gum, Cucurbita Pepo (Pumpkin) Seed Oil, *Arctium Lappa (Burdock) Root Extract, *Carica Papaya (Papaya) Fruit Extract, *Ananas Sativus (Pineapple) Fruit Extract, Panthenol, *Citrus Medica Limonium (Lemon) Peel Extract, Citric Acid, *Rosa Sinensis Linn (Hibiscus) Petal Extract, Squalane (Olive Derived), Tocopherol (Non-GMO), Pure Essential Oils and Leucidal Liquid (Radish Root Ferment). *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\nMix 3-5 drops the booster to your moisturizer, face mask, serum or foundation to revive skin.\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e"}
{"id":10500480579,"title":"JACQ's PROBIOTIC FACE MASK","handle":"probiotic-face-mask-1","description":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-14T12:12:34-04:00","created_at":"2017-06-09T16:34:13-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","antioxidant","booster","Carrot","emollient","essential oils","Face Mask","face oil","face serum","jackfruit","moisturizer","papaya","protein","skin serum","vitamin E","yucca"],"price":2300,"price_min":2300,"price_max":2300,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40636604483,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793102598192,"product_id":10500480579,"position":1,"created_at":"2021-08-09T16:22:40-04:00","updated_at":"2021-08-09T16:24:39-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1628540679","variant_ids":[40636604483]},"available":true,"name":"JACQ's PROBIOTIC FACE MASK - 2oz","public_title":"2oz","options":["2oz"],"price":2300,"weight":85,"compare_at_price":null,"inventory_quantity":188,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058609020976,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1628540560"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1628540679","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1628540679","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1628540679","\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsprobioticfacemask937x1075_efe4003d-666a-4729-8141-dcb8f6678803.jpg?v=1628540679"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1628540679","options":["Size"],"media":[{"alt":null,"id":21058609020976,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1628540560"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskset937x1075.jpg?v=1628540560","width":937},{"alt":null,"id":21058585428016,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1628540239"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075_7cf80615-9a8b-4985-91c5-7f47a50a54f6.jpg?v=1628540239","width":937},{"alt":null,"id":21058608988208,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1628540559"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemaskboxes937x1075.jpg?v=1628540559","width":937},{"alt":null,"id":21058594865200,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsprobioticfacemask937x1075_efe4003d-666a-4729-8141-dcb8f6678803.jpg?v=1628540400"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsprobioticfacemask937x1075_efe4003d-666a-4729-8141-dcb8f6678803.jpg?v=1628540400","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Moisturizing Protein Enzyme Beauty Booster to Replenish Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eHave faith! The True Believer a.k.a Tri-Enzyme and Protein Enzyme Booster works to replenish skin with moisture, boosts collagen and restores skin with vitality. \u003cstrong\u003eThe natural Phytochemicals, Tri-Enzymes \u003c\/strong\u003eand\u003cstrong\u003e Proteins beautifully works to quench and replenish skin\u003c\/strong\u003e. Lecithin, \u003cstrong\u003ea natural emollient and antioxidant, attracts water and acts as a moisturizer\u003c\/strong\u003e is a key nutrient found in this collection. Feed your skin a Carrot, Papaya and Jackfruit cocktail.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Medicago Sativa (Alfalfa) Extract, Aloifolia (Yucca) Root Extract, Achillea (Yarrow) Millefolium Extract, Carica Papaya (Papaya) Extract, Ginkgo Bilobae (Ginkgo Bilboa) Extractum Extract and Daucus (Carrot) Aucus Carota Extract, Artocarpus (Jackfruit) Heterophyllus Seed Extract, Aloe Barbadensis Leaf Extract, Panthenol, Pure Essential Oils, Tocopherol (Non-GMO) Vitamin E and Ferulic Acid. *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's  Drip Collection Trilogy Beauty Booster Skincare Bundle - Save $10
{"id":10612520899,"title":"JACQ's Drip Collection Trilogy Beauty Booster Skincare Bundle - Save $10","handle":"beauty-boosting-trio","description":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e","published_at":"2017-07-11T19:04:44-04:00","created_at":"2017-07-09T17:02:19-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["almond","beauty booster","booster","chamomile","face oil","face serum","moringa","protein","protein booster","skin serum","yucca"],"price":6500,"price_min":6500,"price_max":6500,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42098492355,"title":"1","option1":"1","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793140805680,"product_id":10612520899,"position":1,"created_at":"2021-08-09T16:36:51-04:00","updated_at":"2021-08-09T16:39:03-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","variant_ids":[42098492355]},"available":true,"name":"JACQ's Drip Collection Trilogy Beauty Booster Skincare Bundle - Save $10 - 1","public_title":"1","options":["1"],"price":6500,"weight":5,"compare_at_price":null,"inventory_quantity":263,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541411"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541543","options":["1 Pack"],"media":[{"alt":null,"id":21058653454384,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541411"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsdripcollection937x1075.jpg?v=1628541411","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Certified Organic Beauty Booster Skin Serum Pack of 3 \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca href=\"#tab1\" class=\"active\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli id=\"tab1\" class=\"active\"\u003eWe get it, life happens. Stress, work, hormones and there may be times when you just are not taking the best care of your skin.  Mix-and-match these concentrated beauty boosters to boost, feed, and heal your skin. Since you know your skin best, create the perfect slay ritual using our individual potent booster to treat, boost, and nourish your skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, Achillea Millefolium (Yarrow) Extract, Hibiscus Rosa (Hibiscus) Sinensis Extract, Calendula Officinalis Extract, Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cbr\u003e\u003c\/li\u003e\n\u003c\/ul\u003e"}
JACQ's Restorative Face Serum JACQ's Restorative Face Serum
{"id":10636301379,"title":"JACQ's Restorative Face Serum","handle":"the-protector-beauty-booster","description":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-07-14T12:14:52-04:00","created_at":"2017-07-14T13:01:45-04:00","vendor":"Jacq's Organics","type":"Skin Care","tags":["amino acids","booster","chamomile","hibiscus","Moringa","plant nutrients","Vitamin A","Vitamin D"],"price":2400,"price_min":2400,"price_max":2400,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":42338644867,"title":"1oz","option1":"1oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":28793074614320,"product_id":10636301379,"position":1,"created_at":"2021-08-09T16:11:09-04:00","updated_at":"2021-08-09T17:44:38-04:00","alt":null,"width":937,"height":1075,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","variant_ids":[42338644867]},"available":true,"name":"JACQ's Restorative Face Serum - 1oz","public_title":"1oz","options":["1oz"],"price":2400,"weight":5,"compare_at_price":null,"inventory_quantity":83,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","featured_media":{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628539869"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628545478","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628545478"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628545478","options":["Size"],"media":[{"alt":null,"id":21058578612272,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628539869"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserum937x1075.png?v=1628539869","width":937},{"alt":null,"id":21058578481200,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628539852"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumcloseup.png?v=1628539852","width":937},{"alt":null,"id":21058578513968,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628539851"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumfront.jpg?v=1628539851","width":937},{"alt":null,"id":21058578546736,"position":4,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628539851"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsrestorativefaceserumside937x1075.jpg?v=1628539851","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003eJACQ's Fragrance-Free Vitamin-Packed Skin Booster \u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003eMeet \u003cstrong\u003eThe Protector our Our Bio-Vitamin Booster formulated for delicate skin or when your skin needs a little\u003c\/strong\u003e TLC. This illuminating and healing \u003cstrong\u003econcentrated booster is fragrance-free and contains a powerful and potent super blend of\u003c\/strong\u003e\u003cstrong\u003e Moringa, Alfalfa, sweet Yarrow and floral essences\u003c\/strong\u003e that work together to feed your skin. Our signature infusion blend contains bio-active plant nutrients, vitamins a, d amino acids to calm and soothe skin.\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003ePrunus Amygdalus Dulcis (Sweet Almond) Oil, *Moringa (Moringa) Oleifera Extract, Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Achillea Millefolium (Yarrow) Extract, *Hibiscus Rosa (Hibiscus) Senensis Extract, Calendula Officinalis Extract, *Yucca Glauca Root Extract, Panthenol, Pure Essential Oils and Tocopherol (Non-GMO), *Certified Organic\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003eTab 3 content\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e18 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e"}
JACQ's Travel Size Organic Healing Face Cleanser JACQ's healing face cleanser, pink label, clear bottle
{"id":2157874118704,"title":"JACQ's Travel Size Organic Healing Face Cleanser","handle":"mini-healing-face-cleanser","description":"\u003ch3\u003e\u003c\/h3\u003e\n\u003ch2\u003eJACQ's Vegan, Cruelty-Free Face Cleanser for Oily\/Combination Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003e\n\u003cspan\u003eNow in a travel size, JACQ's game-changing organic, vegan \u0026amp; cruelty-free face cleanser \u003c\/span\u003e\u003cstrong\u003edissolves dirt, makeup, and impurities on the skin.\u003c\/strong\u003e\u003cspan\u003e Creamy in texture, pink in color this face cleanser is formulated with rich \u003c\/span\u003e\u003cstrong\u003eAmino Acids, Fruit Enzymes\u003c\/strong\u003e\u003cspan\u003e found in \u003c\/span\u003e\u003cstrong\u003ePapaya Extract\u003c\/strong\u003e\u003cspan\u003e to gently remove dead cells. Skin conditioning \u003c\/span\u003e\u003cstrong\u003eVitamin B3\u003c\/strong\u003e\u003cspan\u003e and healing \u003c\/span\u003e\u003cstrong\u003eMoringa Extract\u003c\/strong\u003e\u003cspan\u003e all work together to leave the skin feeling clean and refreshed.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e\u003cspan\u003eWater (Aqua), *Helianthus Annuus (Sunflower) Seed Oil, *Cocos Nucifera (Coconut) Oil, *Ricinus Communis (Castor) Seed Oil, , Potassium hydroxide, *Glycerin, *Citric acid, Moringa Oleifera Seed Extract, Carica Papaya (Papaya) Fruit Extract, Spearmint Oil, Eucalyptus Oil, Peppermint Oil, Ginger Oil, Pure Essential Oils and Kaolinite (Rose Clay). *Certified Organic\u003c\/span\u003e\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cspan\u003eMassage onto wet skin, work into a lather, inhale the aroma and rinse. Avoid eye area.\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003ch4\u003e\u003cstrong\u003eJACQ's KEY INGREDIENTS\u003c\/strong\u003e\u003c\/h4\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003ePapaya \u003c\/b\u003ehigh in Vitamin A \u0026amp; E, omega fatty acids, and papain enzymes. Papain enzymes work to gently exfoliate the skin while removing dead skin cells.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eMoringa \u003c\/b\u003eis a rich source of fatty acids great for nourishing the skin. It easily absorbs into skin, a powerful plant that fights inflammation and helps protect against free-radical damage.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Clay\u003c\/strong\u003e easily \u003cspan\u003eabsorbs impurities from the\u003cstrong\u003e \u003c\/strong\u003e\u003c\/span\u003eskin\u003cspan\u003e, such as dirt, makeup, and oils.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"Organic Ingredients, Leaf icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_compact.jpg?v=1517023823\" alt=\"vegan friendly, pig icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\" alt=\"oily\/combination skin, globe icon\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e","published_at":"2017-07-14T12:13:43-04:00","created_at":"2018-11-26T11:16:27-05:00","vendor":"Jacq's Organics","type":"Skin Care","tags":[],"price":1000,"price_min":1000,"price_max":1000,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":21688097177648,"title":"2oz","option1":"2oz","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":{"id":15389311074352,"product_id":2157874118704,"position":2,"created_at":"2020-07-16T10:14:44-04:00","updated_at":"2021-08-09T17:22:22-04:00","alt":"JACQ's healing face cleanser, pink label, clear bottle","width":934,"height":1064,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront_8c75afcb-c833-436f-8040-9edd6529cca3.jpg?v=1628544142","variant_ids":[21688097177648]},"available":true,"name":"JACQ's Travel Size Organic Healing Face Cleanser - 2oz","public_title":"2oz","options":["2oz"],"price":1000,"weight":170,"compare_at_price":null,"inventory_quantity":516,"inventory_management":"shopify","inventory_policy":"continue","barcode":"","featured_media":{"alt":"JACQ's healing face cleanser, pink label, clear bottle","id":7562705862704,"position":2,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront_8c75afcb-c833-436f-8040-9edd6529cca3.jpg?v=1594908884"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSHEALINGFACECLEANSER2OZ937X1075.jpg?v=1628544142","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront_8c75afcb-c833-436f-8040-9edd6529cca3.jpg?v=1628544142","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserback_ce167975-3071-4148-aeff-273f857b4aef.jpg?v=1628544142"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSHEALINGFACECLEANSER2OZ937X1075.jpg?v=1628544142","options":["Size"],"media":[{"alt":null,"id":21058709880880,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSHEALINGFACECLEANSER2OZ937X1075.jpg?v=1628544137"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSHEALINGFACECLEANSER2OZ937X1075.jpg?v=1628544137","width":937},{"alt":"JACQ's healing face cleanser, pink label, clear bottle","id":7562705862704,"position":2,"preview_image":{"aspect_ratio":0.878,"height":1064,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront_8c75afcb-c833-436f-8040-9edd6529cca3.jpg?v=1594908884"},"aspect_ratio":0.878,"height":1064,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserfront_8c75afcb-c833-436f-8040-9edd6529cca3.jpg?v=1594908884","width":934},{"alt":"JACQ's travel size face cleanser, pink label, skincare ingredients","id":7562705829936,"position":3,"preview_image":{"aspect_ratio":0.863,"height":1070,"width":923,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserback_ce167975-3071-4148-aeff-273f857b4aef.jpg?v=1594908885"},"aspect_ratio":0.863,"height":1070,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqs2ozhealingfacecleanserback_ce167975-3071-4148-aeff-273f857b4aef.jpg?v=1594908885","width":923}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch3\u003e\u003c\/h3\u003e\n\u003ch2\u003eJACQ's Vegan, Cruelty-Free Face Cleanser for Oily\/Combination Skin\u003c\/h2\u003e\n\u003cul class=\"tabs\"\u003e\n\u003cli\u003e\u003ca class=\"active\" href=\"#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli\u003e\u003ca href=\"#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\"\u003e\n\u003cli class=\"active\" id=\"tab1\"\u003e\n\u003cspan\u003eNow in a travel size, JACQ's game-changing organic, vegan \u0026amp; cruelty-free face cleanser \u003c\/span\u003e\u003cstrong\u003edissolves dirt, makeup, and impurities on the skin.\u003c\/strong\u003e\u003cspan\u003e Creamy in texture, pink in color this face cleanser is formulated with rich \u003c\/span\u003e\u003cstrong\u003eAmino Acids, Fruit Enzymes\u003c\/strong\u003e\u003cspan\u003e found in \u003c\/span\u003e\u003cstrong\u003ePapaya Extract\u003c\/strong\u003e\u003cspan\u003e to gently remove dead cells. Skin conditioning \u003c\/span\u003e\u003cstrong\u003eVitamin B3\u003c\/strong\u003e\u003cspan\u003e and healing \u003c\/span\u003e\u003cstrong\u003eMoringa Extract\u003c\/strong\u003e\u003cspan\u003e all work together to leave the skin feeling clean and refreshed.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003cli id=\"tab2\"\u003e\u003cspan\u003eWater (Aqua), *Helianthus Annuus (Sunflower) Seed Oil, *Cocos Nucifera (Coconut) Oil, *Ricinus Communis (Castor) Seed Oil, , Potassium hydroxide, *Glycerin, *Citric acid, Moringa Oleifera Seed Extract, Carica Papaya (Papaya) Fruit Extract, Spearmint Oil, Eucalyptus Oil, Peppermint Oil, Ginger Oil, Pure Essential Oils and Kaolinite (Rose Clay). *Certified Organic\u003c\/span\u003e\u003c\/li\u003e\n\u003cli id=\"tab3\"\u003e\u003cspan\u003eMassage onto wet skin, work into a lather, inhale the aroma and rinse. Avoid eye area.\u003c\/span\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003e\u003cstrong\u003e27 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/h3\u003e\n\u003ch4\u003e\u003cstrong\u003eJACQ's KEY INGREDIENTS\u003c\/strong\u003e\u003c\/h4\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cb\u003ePapaya \u003c\/b\u003ehigh in Vitamin A \u0026amp; E, omega fatty acids, and papain enzymes. Papain enzymes work to gently exfoliate the skin while removing dead skin cells.\u003c\/li\u003e\n\u003cli\u003e\n\u003cb\u003eMoringa \u003c\/b\u003eis a rich source of fatty acids great for nourishing the skin. It easily absorbs into skin, a powerful plant that fights inflammation and helps protect against free-radical damage.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eRose Clay\u003c\/strong\u003e easily \u003cspan\u003eabsorbs impurities from the\u003cstrong\u003e \u003c\/strong\u003e\u003c\/span\u003eskin\u003cspan\u003e, such as dirt, makeup, and oils.\u003c\/span\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_compact.jpg?v=1517023823\" alt=\"Organic Ingredients, Leaf icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_compact.jpg?v=1517023823\" alt=\"all skin types, pink hand icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_compact.jpg?v=1517023823\" alt=\"vegan friendly, pig icon\" style=\"float: none;\"\u003e\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/OILY_COMBO_SKIN_ICON_compact.jpg?v=1517023823\" alt=\"oily\/combination skin, globe icon\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e"}

JACQ's Travel Size Organic Healing Face Cleanser

$ 10.00
JACQ's Vegan, Cruelty-Free Face Cleanser for Oily/Combination Skin PRODUCT INFO INGREDIENTS HOW TO USE Now in a travel size, JACQ's game-changing organic, vegan & cruelty-free face cleanser dissolves dirt, makeup, and impurities on the skin. Creamy in texture, pink in color this face cleanser is formulated with rich Amino Acids, Fruit Enzymes found in Papaya Extract to gently...
Asian woman, eyes closed, JACQ's logo 2 Black Women, JACQ's pink logo
{"id":4534950723632,"title":"JACQ's Skincare Gift Card","handle":"jacqs-beauty-skincare-gift-card","description":"\u003cp\u003eShopping for someone else but not sure what to give them? Give them the gift of choice with a JACQ's online gift card. Let them decide on what products to add to their new skincare regimen.\u003c\/p\u003e\n\u003cp\u003eGift cards are delivered by email and contain instructions to redeem them at checkout. Our gift cards have no additional processing fees, and never expire.\u003c\/p\u003e","published_at":"2020-05-16T20:37:49-04:00","created_at":"2020-05-06T15:17:10-04:00","vendor":"Jacq's ","type":"Gift Card","tags":["gift card"],"price":2500,"price_min":2500,"price_max":10000,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":31996489138224,"title":"$25.00 USD","option1":"$25.00 USD","option2":null,"option3":null,"sku":"","requires_shipping":false,"taxable":false,"featured_image":{"id":15390386454576,"product_id":4534950723632,"position":1,"created_at":"2020-07-16T14:35:17-04:00","updated_at":"2020-08-01T20:55:39-04:00","alt":"Asian woman, eyes closed, JACQ's logo","width":938,"height":1069,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSGIFTCARD.jpg?v=1596329739","variant_ids":[31996489138224]},"available":true,"name":"JACQ's Skincare Gift Card - $25.00 USD","public_title":"$25.00 USD","options":["$25.00 USD"],"price":2500,"weight":0,"compare_at_price":null,"inventory_quantity":-13,"inventory_management":null,"inventory_policy":"continue","barcode":"","featured_media":{"alt":"Asian woman, eyes closed, JACQ's logo","id":7563781537840,"position":1,"preview_image":{"aspect_ratio":0.877,"height":1069,"width":938,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSGIFTCARD.jpg?v=1594924517"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":31996489170992,"title":"$75.00","option1":"$75.00","option2":null,"option3":null,"sku":"","requires_shipping":false,"taxable":false,"featured_image":{"id":15390394384432,"product_id":4534950723632,"position":2,"created_at":"2020-07-16T14:37:09-04:00","updated_at":"2020-08-01T20:55:51-04:00","alt":"2 Black Women, JACQ's pink logo","width":934,"height":1067,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSGIFTCARD2.jpg?v=1596329751","variant_ids":[31996489170992]},"available":true,"name":"JACQ's Skincare Gift Card - $75.00","public_title":"$75.00","options":["$75.00"],"price":7500,"weight":0,"compare_at_price":null,"inventory_quantity":-1,"inventory_management":null,"inventory_policy":"continue","barcode":"","featured_media":{"alt":"2 Black Women, JACQ's pink logo","id":7563789566000,"position":2,"preview_image":{"aspect_ratio":0.875,"height":1067,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSGIFTCARD2.jpg?v=1594924629"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":31996489203760,"title":"$50.00 USD","option1":"$50.00 USD","option2":null,"option3":null,"sku":"","requires_shipping":false,"taxable":false,"featured_image":{"id":15402577035312,"product_id":4534950723632,"position":4,"created_at":"2020-07-19T10:18:38-04:00","updated_at":"2020-08-01T20:56:20-04:00","alt":"Woman of color, wearing robe, JACQ's gray logo","width":380,"height":435,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/6.png?v=1596329780","variant_ids":[31996489203760]},"available":true,"name":"JACQ's Skincare Gift Card - $50.00 USD","public_title":"$50.00 USD","options":["$50.00 USD"],"price":5000,"weight":0,"compare_at_price":null,"inventory_quantity":-7,"inventory_management":null,"inventory_policy":"continue","barcode":"","featured_media":{"alt":"Woman of color, wearing robe, JACQ's gray logo","id":7575977918512,"position":4,"preview_image":{"aspect_ratio":0.874,"height":435,"width":380,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/6.png?v=1595168318"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":31996489236528,"title":"$100.00 USD","option1":"$100.00 USD","option2":null,"option3":null,"sku":"","requires_shipping":false,"taxable":false,"featured_image":{"id":15402577526832,"product_id":4534950723632,"position":5,"created_at":"2020-07-19T10:19:00-04:00","updated_at":"2020-08-01T20:56:36-04:00","alt":"Woman of color, smiling, JACQ's white logo overaly","width":380,"height":435,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/7.png?v=1596329796","variant_ids":[31996489236528]},"available":true,"name":"JACQ's Skincare Gift Card - $100.00 USD","public_title":"$100.00 USD","options":["$100.00 USD"],"price":10000,"weight":0,"compare_at_price":null,"inventory_quantity":0,"inventory_management":null,"inventory_policy":"continue","barcode":"","featured_media":{"alt":"Woman of color, smiling, JACQ's white logo overaly","id":7575978410032,"position":5,"preview_image":{"aspect_ratio":0.874,"height":435,"width":380,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/7.png?v=1595168340"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSGIFTCARD.jpg?v=1596329739","\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSGIFTCARD2.jpg?v=1596329751","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsproteinbeautybooster.png?v=1596329764","\/\/\/s\/files\/1\/0877\/4074\/products\/6.png?v=1596329780","\/\/\/s\/files\/1\/0877\/4074\/products\/7.png?v=1596329796"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSGIFTCARD.jpg?v=1596329739","options":["Title"],"media":[{"alt":"Asian woman, eyes closed, JACQ's logo","id":7563781537840,"position":1,"preview_image":{"aspect_ratio":0.877,"height":1069,"width":938,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSGIFTCARD.jpg?v=1594924517"},"aspect_ratio":0.877,"height":1069,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSGIFTCARD.jpg?v=1594924517","width":938},{"alt":"2 Black Women, JACQ's pink logo","id":7563789566000,"position":2,"preview_image":{"aspect_ratio":0.875,"height":1067,"width":934,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSGIFTCARD2.jpg?v=1594924629"},"aspect_ratio":0.875,"height":1067,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSGIFTCARD2.jpg?v=1594924629","width":934},{"alt":"Caucasian woman smiling, JACQ's gray logo","id":7576001577008,"position":3,"preview_image":{"aspect_ratio":0.874,"height":435,"width":380,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsproteinbeautybooster.png?v=1595169174"},"aspect_ratio":0.874,"height":435,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsproteinbeautybooster.png?v=1595169174","width":380},{"alt":"Woman of color, wearing robe, JACQ's gray logo","id":7575977918512,"position":4,"preview_image":{"aspect_ratio":0.874,"height":435,"width":380,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/6.png?v=1595168318"},"aspect_ratio":0.874,"height":435,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/6.png?v=1595168318","width":380},{"alt":"Woman of color, smiling, JACQ's white logo overaly","id":7575978410032,"position":5,"preview_image":{"aspect_ratio":0.874,"height":435,"width":380,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/7.png?v=1595168340"},"aspect_ratio":0.874,"height":435,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/7.png?v=1595168340","width":380}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eShopping for someone else but not sure what to give them? Give them the gift of choice with a JACQ's online gift card. Let them decide on what products to add to their new skincare regimen.\u003c\/p\u003e\n\u003cp\u003eGift cards are delivered by email and contain instructions to redeem them at checkout. Our gift cards have no additional processing fees, and never expire.\u003c\/p\u003e"}

JACQ's Skincare Gift Card

$ 25.00
Shopping for someone else but not sure what to give them? Give them the gift of choice with a JACQ's online gift card. Let them decide on what products to add to their new skincare regimen. Gift cards are delivered by email and contain instructions to redeem them at checkout. Our...
{"id":6547807830064,"title":"JACQ'S EASY PEASEY SKINCARE SLAY KIT","handle":"jacqs-easy-peasey-skincare-slay-kit","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eGet your self-care on, sis!  Indulge and enjoy a session of masking, messy bun, and a delicious moisturizer, lol.  The Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary, and papaya extract. While the Clarifying Face Masque \u0026amp; Scrub detoxifies your skin and feeds it minerals and active ingredients. Bring it all together with our delicious peptide-packed Nourishing Face Moisturizer to seal in all the moisture and restore that glow! Perfect for the skincare junkie and the lazy skincare queens.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"all skin types, pink icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cstrong\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" alt=\"Vegan-friendly, bird icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" alt=\"Cruelty-free, monkey icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" alt=\"organic ingredients, leaf icon\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e","published_at":"2021-03-17T16:31:19-04:00","created_at":"2021-03-17T16:01:37-04:00","vendor":"Jacq's Organics","type":"Gifts","tags":["beauty balm","bundle","cleanser","Face Mask","face scrub","face toner","gift set","skincare"],"price":6500,"price_min":6500,"price_max":6500,"available":true,"price_varies":false,"compare_at_price":7000,"compare_at_price_min":7000,"compare_at_price_max":7000,"compare_at_price_varies":false,"variants":[{"id":39334934806576,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ'S EASY PEASEY SKINCARE SLAY KIT","public_title":null,"options":["Default Title"],"price":6500,"weight":454,"compare_at_price":7000,"inventory_quantity":76,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSEASYYPEAST.png?v=1616011476","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealingfacecleanserandclarifyingfacemask937x1075.jpg?v=1628541662","\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075.jpg?v=1628541668"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSEASYYPEAST.png?v=1616011476","options":["Title"],"media":[{"alt":null,"id":20313003655216,"position":1,"preview_image":{"aspect_ratio":0.878,"height":1067,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSEASYYPEAST.png?v=1616011469"},"aspect_ratio":0.878,"height":1067,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQSEASYYPEAST.png?v=1616011469","width":937},{"alt":null,"id":21058657419312,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealingfacecleanserandclarifyingfacemask937x1075.jpg?v=1628541662"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqshealingfacecleanserandclarifyingfacemask937x1075.jpg?v=1628541662","width":937},{"alt":null,"id":21058657517616,"position":3,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075.jpg?v=1628541668"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsnourishingfacemoisturizer937x1075.jpg?v=1628541668","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eGet your self-care on, sis!  Indulge and enjoy a session of masking, messy bun, and a delicious moisturizer, lol.  The Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary, and papaya extract. While the Clarifying Face Masque \u0026amp; Scrub detoxifies your skin and feeds it minerals and active ingredients. Bring it all together with our delicious peptide-packed Nourishing Face Moisturizer to seal in all the moisture and restore that glow! Perfect for the skincare junkie and the lazy skincare queens.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg style=\"float: none;\" alt=\"all skin types, pink icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\"\u003e\u003cstrong\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" alt=\"Vegan-friendly, bird icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" alt=\"Cruelty-free, monkey icon\"\u003e\u003cimg style=\"float: none;\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" alt=\"organic ingredients, leaf icon\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e"}


$ 65.00 $ 70.00
JACQ's Vegan-Friendly Skincare Kit for All Skin Types WHAT IT IS: Get your self-care on, sis!  Indulge and enjoy a session of masking, messy bun, and a delicious moisturizer, lol.  The Healing Face Cleanser refreshes and purifies the skin with peppermint, rosemary, and papaya extract. While the Clarifying Face Masque...
JACQ's Dewy AF Vegan Skincare Kit
{"id":6564384309296,"title":"JACQ's Dewy AF Vegan Skincare Kit","handle":"jacqs-dewy-af-vegan-skincare-kit","description":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e Meet the newest set on the block. Our Nourishing Face Moisturizer and Hibiscus \u0026amp; Carrot Beauty Bar gently cleanse your face to treating acne breakouts and hydrate and treating bumpy skin and dryness\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"Vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" style=\"float: none;\"\u003e\u003cimg alt=\"Cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box.\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e","published_at":"2021-04-09T18:59:59-04:00","created_at":"2021-04-09T18:58:00-04:00","vendor":"Jacq's Organics","type":"Gifts","tags":["beauty balm","bundle","cleanser","Face Mask","face scrub","face toner","gift set","skincare"],"price":3100,"price_min":3100,"price_max":3100,"available":true,"price_varies":false,"compare_at_price":3500,"compare_at_price_min":3500,"compare_at_price_max":3500,"compare_at_price_varies":false,"variants":[{"id":39431386660912,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Dewy AF Vegan Skincare Kit","public_title":null,"options":["Default Title"],"price":3100,"weight":170,"compare_at_price":3500,"inventory_quantity":33,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/JACQScarrotmoisturizer.jpg?v=1618009165"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/JACQScarrotmoisturizer.jpg?v=1618009165","options":["Title"],"media":[{"alt":null,"id":20473022087216,"position":1,"preview_image":{"aspect_ratio":0.878,"height":1067,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQScarrotmoisturizer.jpg?v=1618009165"},"aspect_ratio":0.878,"height":1067,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/JACQScarrotmoisturizer.jpg?v=1618009165","width":937}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2\u003e\u003cstrong\u003eJACQ's Vegan-Friendly Skincare Kit for All Skin Types\u003c\/strong\u003e\u003c\/h2\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT IT IS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e Meet the newest set on the block. Our Nourishing Face Moisturizer and Hibiscus \u0026amp; Carrot Beauty Bar gently cleanse your face to treating acne breakouts and hydrate and treating bumpy skin and dryness\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eJACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT DETAILS:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\n\u003cimg src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/all_skin_types_jacqs_organics_small.jpg?v=1499304412\" alt=\"all skin types, pink icon\" style=\"float: none;\"\u003e\u003cstrong\u003e\u003cimg alt=\"Vegan-friendly, bird icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/VEGAN_FRIENDLY_CHICK_small.jpg?v=1499297239\" style=\"float: none;\"\u003e\u003cimg alt=\"Cruelty-free, monkey icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/CRUELTY_FREE_ICON_MONKEY_small.jpg?v=1499297275\" style=\"float: none;\"\u003e\u003cimg alt=\"organic ingredients, leaf icon\" src=\"\/\/\/s\/files\/1\/0877\/4074\/files\/ORGANIC_INGREDIENT_ICON_small.jpg?v=1499295818\" style=\"float: none;\"\u003e\u003c\/strong\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cp\u003e\u003cstrong\u003eWHAT'S IN JACQ's DETOX \u0026amp; GLOW VEGAN SKINCARE KIT:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cem\u003ePackaged in a gift-ready box.\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003e\u003cspan\u003eSee links for the full list of ingredients, benefits, uses and directions++ \u003c\/span\u003e\u003c\/em\u003e\u003c\/p\u003e"}

JACQ's Dewy AF Vegan Skincare Kit

$ 31.00 $ 35.00
JACQ's Vegan-Friendly Skincare Kit for All Skin Types WHAT IT IS:  Meet the newest set on the block. Our Nourishing Face Moisturizer and Hibiscus & Carrot Beauty Bar gently cleanse your face to treating acne breakouts and hydrate and treating bumpy skin and dryness JACQ's DETOX & GLOW VEGAN SKINCARE...
JACQ's Probiotic Face Mask JACQ's Probiotic Face Mask
{"id":4112506454064,"title":"JACQ's Probiotic Face Mask","handle":"probiotic-face-mask","description":"\u003ch2 data-mce-fragment=\"1\"\u003eVegan-Friendly Face Serum with vitamin boost\u003c\/h2\u003e\n\u003cp data-mce-fragment=\"1\"\u003e10 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cul class=\"tabs\" data-mce-fragment=\"1\"\u003e\n\u003cli data-mce-fragment=\"1\"\u003e\u003ca class=\"active\" href=\"https:\/\/\/admin\/products\/10500458115#tab1\" data-mce-fragment=\"1\" data-mce-href=\"https:\/\/\/admin\/products\/10500458115#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli data-mce-fragment=\"1\"\u003e\u003ca href=\"https:\/\/\/admin\/products\/10500458115#tab2\" data-mce-fragment=\"1\" data-mce-href=\"https:\/\/\/admin\/products\/10500458115#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli data-mce-fragment=\"1\"\u003e\u003ca href=\"https:\/\/\/admin\/products\/10500458115#tab3\" data-mce-fragment=\"1\" data-mce-href=\"https:\/\/\/admin\/products\/10500458115#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\" data-mce-fragment=\"1\"\u003e\n\u003cli class=\"active\" id=\"tab1\" data-mce-fragment=\"1\"\u003eThe root of a\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003e\u003cstrong data-mce-fragment=\"1\"\u003ecarrot contains 89% water.\u003c\/strong\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eThis magical plant is high in\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003e\u003cstrong data-mce-fragment=\"1\"\u003eBeta-carotene, Minerals and Vitamins A, B, C and E\u003c\/strong\u003e. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result is hydrating and supple skin.\u003c\/li\u003e\n\u003cli id=\"tab2\" data-mce-fragment=\"1\"\u003e*Carthamus (Safflower) Tinctorius, *Rosa Canina (Rosehip) Seed Fruit Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Falcatum (Bupleurum) Root Extract, *Rumex (Yellow Dock) Crispus Extract, *Gentiana Lutea (Gentian) Root Extract, *Aloe Barbadensis Extract, Glycerin, Hippophae Rhamnoides (Sea Buckthorn Berry) CO2 extract, *Pelargonium (Rose Geranium) Graveolens Oil, *Ocimum Basillicum (Basil) Oil, Panthenol, Pure Essential Oils, Tocopherol (non-GM0) and Ferulic Acid. **Certified Organic Ingredient\u003c\/li\u003e\n\u003cli id=\"tab3\" data-mce-fragment=\"1\"\u003eA little goes a long way. Warm one to two drops between hands then gently press onto damp face, neck and decolletage.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp data-mce-fragment=\"1\"\u003e\u003cstrong data-mce-fragment=\"1\"\u003e 20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e\n\u003ch3 data-mce-fragment=\"1\"\u003e\n\u003cstrong data-mce-fragment=\"1\"\u003eKEY\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003e\u003c\/strong\u003e\u003cstrong data-mce-fragment=\"1\"\u003eINGREDIENTS\u003c\/strong\u003e FOR JACQ'S ORGANIC FACE SERUM\u003c\/h3\u003e\n\u003cul data-mce-fragment=\"1\"\u003e\n\u003cli data-mce-fragment=\"1\"\u003e\n\u003cstrong data-mce-fragment=\"1\"\u003eCarrot\u003c\/strong\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eis a natural source of beta-carotene, biotin and lycopene. Great for feeding skin antioxidants, cellular reproduction and improving skin texture.\u003c\/li\u003e\n\u003cli data-mce-fragment=\"1\"\u003e\n\u003cstrong data-mce-fragment=\"1\"\u003eRose Geranium\u003c\/strong\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eis an aromatic, floral and sweet essential oil that's an ideal ingredient that \u003cspan data-mce-fragment=\"1\"\u003epromotes \u003c\/span\u003e\u003cem data-mce-fragment=\"1\"\u003eskin\u003c\/em\u003e\u003cspan data-mce-fragment=\"1\"\u003e cell renewal and ideal ingredient for all skin for every skin type.\u003c\/span\u003e \u003c\/li\u003e\n\u003cli data-mce-fragment=\"1\"\u003e\n\u003cstrong data-mce-fragment=\"1\"\u003eFerulic Acid\u003c\/strong\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eis a plant-based antioxidant with a rich source of Vitamin C \u0026amp; E. A beautiful ingredient known to naturally brighten skin.\u003c\/li\u003e\n\u003cli data-mce-fragment=\"1\"\u003e\n\u003cstrong data-mce-fragment=\"1\"\u003eRosehip Seed Oil\u003c\/strong\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eis packed with vitamins, antioxidants and essential fatty acids that help combat uneven skin tone and fine lines. \u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp data-mce-fragment=\"1\"\u003e \u003c\/p\u003e","published_at":"2021-08-09T16:09:17-04:00","created_at":"2019-09-19T18:41:36-04:00","vendor":"Jacq's","type":"Face","tags":["Face Mask"],"price":2100,"price_min":2100,"price_max":2100,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":30217902260272,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"JACQ's Probiotic Face Mask","public_title":null,"options":["Default Title"],"price":2100,"weight":85,"compare_at_price":null,"inventory_quantity":86,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075.jpg?v=1628539604","\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsprobioticfacemask937x1075.jpg?v=1628539604","\/\/\/s\/files\/1\/0877\/4074\/products\/1.png?v=1628539604","\/\/\/s\/files\/1\/0877\/4074\/products\/2.png?v=1628539604"],"featured_image":"\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075.jpg?v=1628539604","options":["Title"],"media":[{"alt":null,"id":21058572517424,"position":1,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075.jpg?v=1628539381"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/jacqsprobioticfacemask934x1075.jpg?v=1628539381","width":937},{"alt":null,"id":21058574778416,"position":2,"preview_image":{"aspect_ratio":0.872,"height":1075,"width":937,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsprobioticfacemask937x1075.jpg?v=1628539604"},"aspect_ratio":0.872,"height":1075,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/Jacqsprobioticfacemask937x1075.jpg?v=1628539604","width":937},{"alt":null,"id":20923923562544,"position":3,"preview_image":{"aspect_ratio":0.75,"height":4000,"width":3000,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/1.png?v=1626717622"},"aspect_ratio":0.75,"height":4000,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/1.png?v=1626717622","width":3000},{"alt":null,"id":20923924414512,"position":4,"preview_image":{"aspect_ratio":0.75,"height":4000,"width":3000,"src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/2.png?v=1626717646"},"aspect_ratio":0.75,"height":4000,"media_type":"image","src":"https:\/\/\/s\/files\/1\/0877\/4074\/products\/2.png?v=1626717646","width":3000}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003ch2 data-mce-fragment=\"1\"\u003eVegan-Friendly Face Serum with vitamin boost\u003c\/h2\u003e\n\u003cp data-mce-fragment=\"1\"\u003e10 ACTIVE INGREDIENTS\u003c\/p\u003e\n\u003cul class=\"tabs\" data-mce-fragment=\"1\"\u003e\n\u003cli data-mce-fragment=\"1\"\u003e\u003ca class=\"active\" href=\"https:\/\/\/admin\/products\/10500458115#tab1\" data-mce-fragment=\"1\" data-mce-href=\"https:\/\/\/admin\/products\/10500458115#tab1\"\u003ePRODUCT INFO\u003c\/a\u003e\u003c\/li\u003e\n\u003cli data-mce-fragment=\"1\"\u003e\u003ca href=\"https:\/\/\/admin\/products\/10500458115#tab2\" data-mce-fragment=\"1\" data-mce-href=\"https:\/\/\/admin\/products\/10500458115#tab2\"\u003eINGREDIENTS\u003c\/a\u003e\u003c\/li\u003e\n\u003cli data-mce-fragment=\"1\"\u003e\u003ca href=\"https:\/\/\/admin\/products\/10500458115#tab3\" data-mce-fragment=\"1\" data-mce-href=\"https:\/\/\/admin\/products\/10500458115#tab3\"\u003eHOW TO USE\u003c\/a\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul class=\"tabs-content\" data-mce-fragment=\"1\"\u003e\n\u003cli class=\"active\" id=\"tab1\" data-mce-fragment=\"1\"\u003eThe root of a\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003e\u003cstrong data-mce-fragment=\"1\"\u003ecarrot contains 89% water.\u003c\/strong\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eThis magical plant is high in\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003e\u003cstrong data-mce-fragment=\"1\"\u003eBeta-carotene, Minerals and Vitamins A, B, C and E\u003c\/strong\u003e. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result is hydrating and supple skin.\u003c\/li\u003e\n\u003cli id=\"tab2\" data-mce-fragment=\"1\"\u003e*Carthamus (Safflower) Tinctorius, *Rosa Canina (Rosehip) Seed Fruit Oil, *Achillea Millefolium (Yarrow) Extract, *Daucus Carota Sativa (Carrot) Root Extract, *Echinacea Purpurea Extract, *Arctium Lappa (Burdock) Extract, *Chamomilla Recutita (Chamomile) Matricaria Flower Extract, *Falcatum (Bupleurum) Root Extract, *Rumex (Yellow Dock) Crispus Extract, *Gentiana Lutea (Gentian) Root Extract, *Aloe Barbadensis Extract, Glycerin, Hippophae Rhamnoides (Sea Buckthorn Berry) CO2 extract, *Pelargonium (Rose Geranium) Graveolens Oil, *Ocimum Basillicum (Basil) Oil, Panthenol, Pure Essential Oils, Tocopherol (non-GM0) and Ferulic Acid. **Certified Organic Ingredient\u003c\/li\u003e\n\u003cli id=\"tab3\" data-mce-fragment=\"1\"\u003eA little goes a long way. Warm one to two drops between hands then gently press onto damp face, neck and decolletage.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp data-mce-fragment=\"1\"\u003e\u003cstrong data-mce-fragment=\"1\"\u003e 20 ACTIVE INGREDIENTS\u003c\/strong\u003e\u003c\/p\u003e\n\u003ch3 data-mce-fragment=\"1\"\u003e\n\u003cstrong data-mce-fragment=\"1\"\u003eKEY\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003e\u003c\/strong\u003e\u003cstrong data-mce-fragment=\"1\"\u003eINGREDIENTS\u003c\/strong\u003e FOR JACQ'S ORGANIC FACE SERUM\u003c\/h3\u003e\n\u003cul data-mce-fragment=\"1\"\u003e\n\u003cli data-mce-fragment=\"1\"\u003e\n\u003cstrong data-mce-fragment=\"1\"\u003eCarrot\u003c\/strong\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eis a natural source of beta-carotene, biotin and lycopene. Great for feeding skin antioxidants, cellular reproduction and improving skin texture.\u003c\/li\u003e\n\u003cli data-mce-fragment=\"1\"\u003e\n\u003cstrong data-mce-fragment=\"1\"\u003eRose Geranium\u003c\/strong\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eis an aromatic, floral and sweet essential oil that's an ideal ingredient that \u003cspan data-mce-fragment=\"1\"\u003epromotes \u003c\/span\u003e\u003cem data-mce-fragment=\"1\"\u003eskin\u003c\/em\u003e\u003cspan data-mce-fragment=\"1\"\u003e cell renewal and ideal ingredient for all skin for every skin type.\u003c\/span\u003e \u003c\/li\u003e\n\u003cli data-mce-fragment=\"1\"\u003e\n\u003cstrong data-mce-fragment=\"1\"\u003eFerulic Acid\u003c\/strong\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eis a plant-based antioxidant with a rich source of Vitamin C \u0026amp; E. A beautiful ingredient known to naturally brighten skin.\u003c\/li\u003e\n\u003cli data-mce-fragment=\"1\"\u003e\n\u003cstrong data-mce-fragment=\"1\"\u003eRosehip Seed Oil\u003c\/strong\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eis packed with vitamins, antioxidants and essential fatty acids that help combat uneven skin tone and fine lines. \u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp data-mce-fragment=\"1\"\u003e \u003c\/p\u003e"}

JACQ's Probiotic Face Mask

$ 21.00
Vegan-Friendly Face Serum with vitamin boost 10 ACTIVE INGREDIENTS PRODUCT INFO INGREDIENTS HOW TO USE The root of a carrot contains 89% water. This magical plant is high in Beta-carotene, Minerals and Vitamins A, B, C and E. Combined with cell-regenerating Rose Geranium and our in-house essential oil blend. The result is hydrating and...
Showing items 13 - 17 of 17
We use cookies to improve our website and your shopping experience.By continuing to browse our site, you are consenting to our use of cookies. Read more about our Privacy Policy